Recombinant Saccharomyces cerevisiae Mitochondrial FAD carrier protein FLX1 (FLX1)

Shipped with Ice Packs
In Stock

Description

Biological Function

FLX1 facilitates FAD transport across the mitochondrial inner membrane, critical for:

  • Flavoprotein assembly: Supplies FAD to mitochondrial enzymes like succinate dehydrogenase (SDH) and lipoamide dehydrogenase .

  • Redox balance: Maintains mitochondrial FAD/FMN ratios, preventing oxidative stress .

  • Energy metabolism: Supports SDH activity in the TCA cycle and electron transport chain .

Deletion of FLX1 (flx1Δ) results in:

  • 60–80% reduction in mitochondrial FAD levels .

  • Impaired SDH flavinylation and assembly .

  • Respiration defects on nonfermentable carbon sources (e.g., glycerol) .

  • Increased ROS sensitivity and shortened chronological lifespan .

Table 2: Phenotypic Consequences of FLX1 Deletion

ParameterWild-Typeflx1Δ Mutant
Growth on glycerolNormalImpaired
Mitochondrial FAD/FMN~3:1<1:1
SDH activity100%20–30%
Chronological lifespan10–14 daysReduced by 40%

3.1. FAD Transport Mechanism

  • FLX1 exports FAD synthesized in the mitochondrial matrix to the cytosol, contrary to early hypotheses of FAD import .

  • Evidence: flx1Δ mitochondria retain FAD synthesis but fail to export it .

3.2. Regulation of Flavoproteome

  • FLX1 stabilizes apo-Sdh1p (SDH flavoprotein subunit) post-transcriptionally. flx1Δ strains show 70–90% reduced Sdh1p levels, independent of FAD availability .

  • Cross-talk: Altered SDH activity increases succinate levels, potentially modulating epigenetic regulation via α-ketoglutarate-dependent dioxygenases .

3.3. Therapeutic Relevance

  • FLX1 dysfunction mirrors pathologies in riboflavin-responsive multiple acyl-CoA dehydrogenase deficiency (RR-MADD), linked to human SLC25A32 mutations .

  • Recombinant FLX1 enables in vitro studies of flavin transport defects and drug screening .

Applications of Recombinant FLX1

  • Enzyme kinetics: Measures FAD binding affinity and transport rates using liposome reconstitution .

  • Structural biology: Facilitates cryo-EM or X-ray crystallography to resolve substrate-binding pockets .

  • Drug discovery: Identifies small molecules modulating FAD transport for metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FLX1; YIL134W; Mitochondrial FAD carrier protein FLX1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FLX1
Target Protein Sequence
MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIR SSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGND HKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGF QGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVS VTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCIT FCVYENLKHRL
Uniprot No.

Target Background

Function
Facilitates the transport of FAD from the cytosol to the mitochondrial matrix.
Database Links

KEGG: sce:YIL134W

STRING: 4932.YIL134W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the FLX1 protein and what is its primary function in Saccharomyces cerevisiae?

FLX1 encodes a mitochondrial carrier protein (Flx1p) that functions as the FAD export carrier in Saccharomyces cerevisiae. The protein belongs to the mitochondrial carrier family, exhibiting the characteristic tripartite repeat structure found in these transporters . Biochemical evidence indicates that Flx1p specifically mediates the export of FAD synthesized within mitochondria to the cytosol, playing a crucial role in maintaining proper FAD/FMN ratios within mitochondrial compartments . This function is essential for the activity of various FAD-dependent enzymes in the mitochondria, including succinate dehydrogenase and lipoamide dehydrogenase . The protein's structure and sequence indicate its evolutionarily conserved role in flavin nucleotide transport across the mitochondrial membrane.

How was FLX1 initially identified and characterized?

FLX1 was first identified in respiratory defective mutants of S. cerevisiae that were assigned to complementation group G178 . These mutants exhibited an abnormally low ratio of FAD/FMN in mitochondria, suggesting impaired flavin nucleotide metabolism. The gene was isolated from a yeast genomic library based on its ability to restore wild-type growth properties to a representative G178 mutant . Genetic evidence confirmed that the flavin nucleotide imbalance in these mutants was directly caused by mutations in the FLX1 gene. Sequence analysis located FLX1 on yeast chromosome IX, and its product was identified as a member of the mitochondrial carrier protein family based on sequence homology and structural features .

What phenotypes are observed in FLX1 deletion mutants?

FLX1 deletion (flx1Δ) results in several distinct phenotypes that highlight its importance in mitochondrial function:

  • Loss of FAD export capability from mitochondria to cytosol

  • Maintenance of ability to take up riboflavin, FAD, and FMN into mitochondria

  • Significant reduction (approximately 50%) in the activities of mitochondrial FAD-binding enzymes, particularly lipoamide dehydrogenase and succinate dehydrogenase

  • Decreased amounts of succinate dehydrogenase flavoprotein subunit (Sdh1p)

  • Respiratory defects similar to those observed in the original G178 mutants

These phenotypes collectively demonstrate that Flx1p plays both transport and regulatory roles in mitochondrial function, particularly related to FAD metabolism and utilization.

What is the relationship between FLX1 and FAD metabolism in yeast?

S. cerevisiae exhibits a complex FAD metabolic pathway involving both cytosolic and mitochondrial compartments. While FAD synthetase (converting FMN to FAD) is primarily found in the cytosolic fraction and not in mitochondria, riboflavin kinase (converting riboflavin to FMN) is present in both compartments . Mitochondria can synthesize FAD from imported riboflavin via a mitochondrial FAD synthetase, and the synthesized FAD is subsequently exported to the cytosol via Flx1p .

The transport cycle appears to involve:

  • Uptake of riboflavin into mitochondria via riboflavin transporters

  • Conversion of riboflavin to FMN by mitochondrial riboflavin kinase

  • Synthesis of FAD from FMN by mitochondrial FAD synthetase

  • Export of FAD to the cytosol via Flx1p

This pathway ensures appropriate distribution of FAD between mitochondrial and cytosolic compartments for flavoprotein assembly and function.

How does FLX1 affect mitochondrial enzyme activities?

Deletion of FLX1 results in specific reductions in the activities of FAD-dependent mitochondrial enzymes. Research has established the following mechanisms:

EnzymeEffect of FLX1 deletionUnderlying mechanism
Succinate dehydrogenase (SDH)Decreased activityReduced amount of flavoprotein subunit (Sdh1p) due to post-transcriptional regulation
Lipoamide dehydrogenaseDecreased activityRegulatory effect, specific mechanism not fully established

For succinate dehydrogenase, the decrease in activity is not due to changes in mitochondrial FAD levels or degree of protein flavinylation, but rather to reduced Sdh1p protein levels . This indicates an additional regulatory role for Flx1p beyond its function in FAD transport, involving post-transcriptional control of specific flavoprotein expression.

What methodologies are used to measure FLX1 activity in yeast cells?

Several complementary approaches can be used to assess FLX1 activity:

  • FAD transport assays: Measuring FAD flux across mitochondrial membranes using:

    • Isolated mitochondria preparations

    • Membrane vesicles from wild-type and flx1Δ strains

    • Inhibition studies using compounds like lumiflavin

  • Flavin content measurement: Quantifying FAD/FMN ratios in mitochondrial fractions using:

    • High-performance liquid chromatography (HPLC)

    • Fluorescence spectroscopy techniques

  • Enzyme activity assays: Measuring activities of FAD-dependent enzymes such as:

    • Succinate dehydrogenase (polarographic or spectrophotometric methods)

    • Lipoamide dehydrogenase

  • Expression analysis: Using reporter gene constructs (such as lacZ) fused to genes affected by FLX1, like SDH1

How does FLX1 influence the expression of succinate dehydrogenase flavoprotein subunit (Sdh1p)?

The relationship between FLX1 and SDH1 expression involves a sophisticated post-transcriptional regulatory mechanism. In flx1Δ mutant strains, the amount of Sdh1p protein is significantly reduced, but this occurs without changes to:

  • Mitochondrial FAD levels

  • The degree of flavinylation of the protein

  • The import of the protein into mitochondria

Research using lacZ reporter constructs has demonstrated that this regulation involves specific sequences located upstream of the SDH1 coding region . The regulatory mechanism appears to operate at the level of translation or protein stability rather than transcription. The SDH1 coding sequence itself and downstream regulatory sequences do not appear to be involved in this regulation .

This represents a novel regulatory mechanism where a mitochondrial carrier protein (Flx1p) influences the expression of a key electron transport chain component through specific upstream regulatory sequences, highlighting the complex interplay between mitochondrial transporters and respiratory chain components.

What is the mechanism of FAD transport mediated by Flx1p?

Current evidence suggests a specific mechanism for Flx1p-mediated FAD transport:

  • Directionality: Flx1p primarily functions as an exporter, moving FAD synthesized in mitochondria to the cytosol

  • Specificity: The transport system shows substrate specificity, distinguishing FAD from other flavin species:

    • The export system is distinct from the riboflavin uptake system

    • The export is specifically inhibited by lumiflavin

  • Structural basis: The tripartite repeat structure characteristic of mitochondrial carriers provides the structural foundation for transport

  • Transport efficiency: Biochemical studies demonstrate more efficient flux of FAD across mitochondrial membrane vesicles from wild-type compared to flx1Δ strains

The complete molecular details of the transport cycle, including conformational changes and binding sites, remain areas for further investigation, potentially using techniques such as site-directed mutagenesis and structural biology approaches.

How can Design of Experiments (DoE) methodology be applied to study FLX1 function in recombinant systems?

Design of Experiments (DoE) offers a powerful statistical framework for systematically investigating FLX1 function in recombinant systems. Implementation involves:

  • Variable identification: Key factors affecting FLX1 function might include:

    • Expression levels of FLX1

    • Medium composition (carbon sources, vitamins)

    • Growth conditions (temperature, pH, aeration)

    • Genetic background (strain variations)

  • Experimental design strategy:

    • Fractional factorial designs to screen multiple variables with minimal experiments

    • Response surface methodology to optimize conditions

    • Custom designs for investigating specific interactions

  • Implementation example:

    • Define responses: FAD transport rates, flavoprotein activity, growth rates

    • Select factors and levels (typically 2-3 levels per factor)

    • Design experimental matrix using statistical software (e.g., JMP, as mentioned in )

    • Execute experiments in randomized order

    • Analyze data using regression models, ANOVA, or response surface methods

This approach has been successfully applied to recombinant protein expression in S. cerevisiae and could be adapted specifically for studying FLX1 function, providing insights into the complex interactions governing FAD transport and flavoprotein regulation .

What approaches are most effective for characterizing FLX1 variants in different strain backgrounds?

Characterizing FLX1 variants across strain backgrounds requires a multi-faceted approach:

  • Genetic manipulation techniques:

    • CRISPR-Cas9 for precise genome editing

    • Homologous recombination for gene replacements

    • Plasmid-based expression systems for controlled expression

  • Functional analysis:

    • Reciprocal hemizygosity analysis (RHA) to assess allele-specific effects in hybrid backgrounds

    • Quantitative trait locus (QTL) mapping to identify genetic interactions

    • Complementation tests with wild-type and mutant alleles

  • Phenotypic characterization:

    • Growth assays under respiratory conditions

    • Enzyme activity measurements of FAD-dependent proteins

    • Mitochondrial FAD/FMN ratio determination

    • Fermentation kinetics at different temperatures

For example, research on the S288C and RM11-1a strain backgrounds revealed strain-specific effects of FLX1 variants on fermentation kinetics at low temperatures (12.5°C), where the S288C FLX1 allele provided advantages that were not observed when expressed in the opposing strain background, suggesting the importance of strain-specific genetic contexts .

How does FLX1 contribute to redox homeostasis in yeast mitochondria?

FLX1's role in redox homeostasis involves several interconnected mechanisms:

  • FAD availability regulation: By controlling FAD export from mitochondria, Flx1p influences the availability of this essential cofactor for flavoproteins involved in electron transfer chains and redox reactions

  • Impact on respiratory chain components: The regulatory effect on succinate dehydrogenase affects electron flow through Complex II of the respiratory chain, influencing mitochondrial redox balance

  • Potential interaction with redox systems: Research on thioredoxin reductase-1 (TrxR1) and glutathione reductase (GR) systems suggests potential connections between flavin cofactor metabolism and cellular redox systems

  • Persulfide metabolism connection: Studies have identified links between flavoprotein function and persulfide levels, which are important in sulfide signaling pathways and redox homeostasis

Understanding these connections is essential for comprehending how FLX1 fits into the broader network of redox regulation in yeast mitochondria, with potential implications for oxidative stress responses and metabolic adaptation.

What methodologies are optimal for expressing and purifying recombinant Flx1p for structural and functional studies?

Optimal expression and purification of recombinant Flx1p involves:

  • Expression system selection:

    • E. coli: For high yields but requires optimization for membrane proteins

    • S. cerevisiae: Homologous expression with proper folding and post-translational modifications

    • Insect cells: For higher eukaryotic processing if required

  • Expression optimization using DoE:

    • Key variables: Temperature, inducer concentration, expression time, media composition

    • Example experimental matrix for a fractional factorial design:

    ExperimentTemperature (°C)Inducer (mM)Time (h)Media type
    1180.14Minimal
    2181.016Rich
    3300.116Rich
    4301.04Minimal
  • Purification strategy:

    • Membrane protein extraction using optimized detergents

    • Affinity chromatography (His-tag, GST-tag)

    • Size exclusion chromatography for final purity

  • Functional validation:

    • Reconstitution into liposomes for transport assays

    • Substrate binding studies using fluorescence techniques

    • Activity assays measuring FAD transport

This integrated approach has been successful for other mitochondrial carrier proteins and could be adapted specifically for Flx1p to enable detailed structural and functional studies.

How can FLX1 be manipulated for optimizing recombinant protein production in yeast?

Strategic manipulation of FLX1 for optimizing recombinant protein production involves:

  • Rational engineering approaches:

    • Overexpression to enhance FAD availability for flavoproteins

    • Controlled expression using inducible promoters

    • Modification of regulatory sequences affecting post-transcriptional control

  • Integration with other optimization strategies:

    • Vector design optimization

    • Host strain engineering

    • Fermentation condition optimization

  • Experimental design methodology:

    • Multivariate analysis to identify significant factors and interactions

    • Response surface methodology to optimize expression conditions

  • Potential benefits for specific target proteins:

    • Enhanced production of FAD-dependent recombinant proteins

    • Improved cellular energetics supporting protein synthesis and folding

    • Modulation of redox environment affecting protein folding and stability

This approach recognizes that optimization of recombinant protein production requires consideration of multiple factors beyond simply increasing gene expression, including metabolic balancing and cellular redox state management .

What are the implications of FLX1 research for understanding human mitochondrial FAD transport disorders?

Research on yeast FLX1 provides valuable insights into human mitochondrial FAD transport and related disorders:

  • Evolutionary conservation:

    • The mitochondrial carrier family is highly conserved from yeast to humans

    • Mechanisms of FAD transport are likely to share fundamental features across species

  • Disease relevance:

    • Multiple acyl-CoA dehydrogenase deficiencies (MADD) involve impaired flavin cofactor metabolism

    • Riboflavin-responsive multiple acyl-CoA dehydrogenase deficiency (RR-MADD) specifically relates to flavin transport issues

  • Translational research opportunities:

    • Yeast as a model system for testing human variants

    • Screening potential therapeutic compounds that enhance FAD transport

    • Understanding regulatory mechanisms conserved between yeast and human systems

  • Complementary research approaches:

    • Yeast models expressing human orthologs

    • Comparative studies between yeast and human cell mitochondria

    • Systems biology approaches integrating data across species

This cross-species approach to understanding FAD transport provides a foundation for addressing human mitochondrial disorders related to flavin metabolism and transport.

What cutting-edge approaches are being developed to study the real-time dynamics of FLX1-mediated FAD transport?

Emerging technologies for studying real-time dynamics of FLX1-mediated FAD transport include:

  • Advanced fluorescence techniques:

    • Fluorescence resonance energy transfer (FRET) between labeled FAD and transporter

    • Single-molecule fluorescence for transport kinetics

    • Genetically encoded fluorescent sensors for FAD levels

  • Live cell imaging approaches:

    • Confocal microscopy with fluorescent FAD analogs

    • Super-resolution microscopy for detailed localization studies

    • Time-lapse imaging of FAD distribution in living cells

  • Electrophysiological methods:

    • Patch-clamp of reconstituted channels in artificial membranes

    • Solid-supported membrane electrophysiology for transport measurements

  • Combined 'omics approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Systems biology modeling of FAD transport and metabolism networks

These emerging methodologies promise to provide unprecedented insights into the dynamics and regulation of mitochondrial FAD transport, moving beyond the static measurements that have characterized much of the research to date.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.