Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM21 (TIM21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TIM21; YGR033C; Mitochondrial import inner membrane translocase subunit TIM21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
71-239
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
TIM21
Target Protein Sequence
ASTFTFSGILVIGAVGISAIVIYLILSELFSPSGDTQLFNRAVSMVEKNKDIRSLLQCDD GITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAK ESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSNSKGFLGIRWGPRKD
Uniprot No.

Target Background

Function
TIM21 is an essential component of the TIM23 complex, a mitochondrial inner membrane translocase mediating the import of transit peptide-containing proteins. It maintains close proximity between the TOM and TIM23 complexes. Following its release from the TOM23 complex, TIM21 facilitates protein translocation into the mitochondrial matrix. Within the complex, it antagonizes TIM50, reducing preprotein accumulation at the TOM23 complex and promoting PAM complex dissociation from the TIM23 complex.
Gene References Into Functions
  1. Three Tim23 motifs bind to a single conserved pocket in Tim21. PMID: 25263020
  2. Signal-driven Tim21 release from Tim50 promotes Pam17 recruitment, initiating the formation of the motor-associated TIM23 complex required for matrix transport. PMID: 23403928
  3. Tim21 binds to the TOM complex trans site, maintaining close contact between the two translocases. PMID: 15878866
  4. Tim21 interacts with the respiratory chain, promoting membrane-potential-dependent protein sorting into the inner mitochondrial membrane. PMID: 17113393
Database Links

KEGG: sce:YGR033C

STRING: 4932.YGR033C

Protein Families
TIM21 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the resolved structure of the TIM21 binding domain in Saccharomyces cerevisiae?

The binding domain of Tim21 from Saccharomyces cerevisiae has been crystallized and its structure determined at 1.6 Å resolution. The Tim21 structure represents a new α/β-mixed protein fold with two α-helices flanked by an extended eight-stranded β-sheet. Approximately 50% of the residues are part of well-defined secondary structure elements. The structure begins with a four-repeat long α-helix (α1) at the N-terminus, followed by a short loop connecting to a tilted α2 helix. The α1 helix is flanked by antiparallel β-strands (β4-β8) forming an extended β-sheet, with three hydrogen bonds existing between the helices and the β-sheet .

A DALI database search for structures related to Tim21 IMS did not find any protein with a similar fold, confirming that the Tim21 IMS structure represents a new protein fold in the structural biology database .

What crystallization methods have been successful for TIM21 structural studies?

Initial crystallization trials with untagged Tim21 IMS did not yield any crystalline material. Researchers noticed an unusually high number of crystallization drops remained clear, indicating insufficient protein concentration despite being at 25-30 mg/ml. The breakthrough came when Tim21 IMS was concentrated to approximately 90 mg/ml, resulting in cubical-shaped crystals after 2-4 weeks .

The successful crystallization involved:

  • Expressing the full-length IMS domain (residues 103-239) with an N-terminal His tag

  • Using subtilisin to remove flexible termini that often prevent proteins from crystallizing

  • Identifying a protease-resistant domain through mass spectrometry analysis (residues 103-227 and 103-225)

  • Working with the shorter fragment (residues 103-225) expressed with an N-terminal His tag

  • Significantly increasing protein concentration from 25-30 mg/ml to approximately 90 mg/ml

What are the key crystallographic parameters of the resolved TIM21 structure?

The crystallographic data for TIM21 reveals detailed structural parameters as summarized in the following table:

Data collectionSeMet crystalNative crystal
Space groupP2₁2₁2₁P2₁2₁2₁
Unit cell constants
a (Å)32.132.3
b (Å)59.258.8
c (Å)62.662.6
Resolution (Å)1.91.58
Unique reflections9,503-9,78516,515
Completeness (%)96.2-99.497.5
R-factor/R-free (%)--19.7/24.8
R.m.s.d. of bond lengths (Å)--0.006
R.m.s.d. of bond angles (deg)--1.3
Mean β factor (Ų)--22.9

Tim21 IMS crystallized in the orthorhombic space group P2₁2₁2₁ with one monomer of the protein in the asymmetric unit. The crystal structure was solved using multi-wavelength anomalous dispersion (MAD) experiment on a seleno-methionine (SeMet)-labeled protein .

How does TIM21 facilitate the connection between TOM and TIM23 complexes?

Tim21 serves as a direct connector between the translocase of the outer membrane (TOM complex) and the presequence translocase of the inner membrane (TIM23 complex). This connection is crucial for the formation of translocation contact sites, which facilitate the transfer of preproteins from the outer to the inner mitochondrial membrane .

The intermembrane space (IMS) domain of Tim21 directly binds to the IMS domain of the Tom22 receptor, which is a component of the TOM complex. This interaction has been demonstrated through multiple experimental approaches:

  • Co-elution assays showing that GST-Tom22 IMS binds to Tim21 IMS

  • 1H NMR spectroscopy revealing significant changes in intensity in several Tom22 IMS peaks upon addition of Tim21 IMS

  • Affinity column experiments showing efficient binding of the TOM complex to Tim21 at 80 mM NaCl

The salt sensitivity of the interaction indicates the involvement of electrostatic interactions in the binding of Tim21 to the TOM complex, as the interaction is strongly decreased when washed with higher salt concentrations .

What specific regions of TOM22 are required for interaction with TIM21?

Detailed mapping studies have identified the core sequence of Tom22 that binds to Tim21. Analysis using a Tom22 peptide library, comprising the region from the membrane span to the C terminus, revealed that binding was maximal in a region between residues 123 and 147 .

Further investigations demonstrated that negatively charged amino acid residues of Tom22 are particularly important for binding to Tim21. This finding aligns with the observation that the TIM21-TOM interaction is salt-sensitive, suggesting that electrostatic interactions play a significant role in this protein-protein interface .

What is the historical context of translocation contact sites discovery in relation to TIM21?

Early studies showed that a preprotein arrested during transport across both mitochondrial membranes could stably connect the TOM and TIM23 complexes, as demonstrated by Rassow et al. (1989), Dekker et al. (1997), and Chacinska et al. (2003). While Tim50, an essential subunit of the TIM23 complex, was known to interact with preproteins emerging on the IMS side of the outer membrane, it does not form a direct contact with the TOM complex .

The identification of Tim21 provided the first evidence for a direct contact between TOM and TIM23 complexes, as reported by Chacinska et al. (2005). This discovery represented a significant advancement in understanding the molecular basis of translocation contact sites, a question that had remained open for approximately 20 years .

What are the optimal expression and purification strategies for recombinant TIM21?

Based on the successful structural studies, the following approach has proven effective for the expression and purification of the TIM21 IMS domain:

  • Express the full-length IMS domain of Saccharomyces cerevisiae Tim21 (residues 103-239) with an N-terminal His tag

  • For improved crystallization prospects, use subtilisin to remove flexible termini

  • Identify the protease-resistant core domain using mass spectrometry

  • Express the shorter fragment (residues 103-225) with an N-terminal His tag

  • Purify using Ni-NTA chromatography

  • For interaction studies, use untagged domains

The preparation achieved sufficient purity for both structural studies and interaction analyses. When working with TIM21 for crystallization purposes, it's crucial to concentrate the protein to approximately 90 mg/ml, as lower concentrations (25-30 mg/ml) proved insufficient .

How can researchers effectively study TIM21-TOM22 interactions?

Multiple complementary approaches have been successful in studying the interaction between TIM21 and TOM22:

  • Affinity co-purification: Incubate a GST fusion protein containing Tom22 IMS with Tim21 IMS and subject the mixture to affinity purification using Ni-NTA chromatography. The co-elution of GST-Tom22 IMS with Tim21 IMS indicates binding .

  • NMR spectroscopy: Analyze the interaction of untagged domains using 1H NMR spectroscopy. The addition of increasing amounts of Tim21 IMS leads to significant changes in intensity in several Tom22 IMS peaks, indicating direct interaction between the domains .

  • Affinity column binding assays: Attach purified TIM21 domain to an affinity column and incubate with solubilized mitochondria. The TOM complex binds efficiently to Tim21 at 80 mM NaCl. Test salt sensitivity by washing with increasing salt concentrations to understand the nature of the interaction .

  • Peptide library screening: Use a Tom22 peptide library, comprising regions from the membrane span to the C terminus, to probe with purified IMS domain of Tim21, followed by quantitative analysis to identify specific binding regions .

What techniques are essential for studying structure-function relationships of TIM21?

For comprehensive structure-function analysis of TIM21, researchers should employ a multi-technique approach:

  • X-ray crystallography: For high-resolution structural determination, as demonstrated by the 1.6 Å resolution structure. This requires optimization of protein constructs, as flexible termini may prevent crystallization .

  • Multi-wavelength anomalous dispersion (MAD): Useful for solving the phase problem in protein crystallography, particularly with seleno-methionine (SeMet)-labeled proteins .

  • Database comparisons: Structural comparison tools like DALI can identify related protein folds or novel structural features .

  • Interaction mapping: Techniques like peptide library screening and NMR spectroscopy can identify specific binding regions and residues crucial for protein-protein interactions .

  • Salt sensitivity assays: By testing interactions at various salt concentrations, researchers can determine the contribution of electrostatic interactions to protein binding .

  • Site-directed mutagenesis: While not explicitly mentioned in the search results, this would be a logical next step to test the functional importance of specific residues identified in the structural studies.

How does the unique fold of TIM21 contribute to its functional specificity?

The Tim21 structure represents a new α/β-mixed protein fold with two α-helices flanked by an extended eight-stranded β-sheet. This unique structural arrangement likely contributes to its specific binding properties and functional role in mitochondrial protein import .

Key structural features that may contribute to function include:

  • The arrangement of secondary structure elements with about 50% of residues in well-defined secondary structures

  • The N-terminal four-repeat long α-helix followed by a short loop that connects to the tilted α2 helix

  • The α1 helix flanked by antiparallel β-strands β4-β8 forming an extended β-sheet

  • The three hydrogen bonds between the helices and the β-sheet

  • The extended loop structures flanking helix α1

Advanced research should investigate how these structural features specifically enable TIM21 to interact with TOM22 and potentially other partners. The unique fold may provide specific binding surfaces or conformational flexibility required for its role in connecting protein complexes across mitochondrial membranes .

What are the implications of electrostatic interactions in TIM21-TOM22 binding for protein import regulation?

The salt sensitivity of the TIM21-TOM interaction suggests that electrostatic interactions play a crucial role in this binding. This has several potential implications for regulation of protein import:

  • Physiological regulation: Changes in the ionic environment of the intermembrane space could potentially modulate the strength of TIM21-TOM22 interactions, providing a mechanism for regulating protein import rates.

  • Specificity determinants: The importance of negatively charged amino acid residues in Tom22 for binding to Tim21 suggests that charge complementarity is a key determinant of binding specificity.

  • Dynamic interactions: Electrostatic interactions often enable more dynamic and reversible binding compared to hydrophobic interactions, which may be important for the transient nature of translocation contact sites.

  • Evolutionary conservation: The conservation of charged residues at the interaction interface would be expected if electrostatic interactions are functionally important .

Advanced research questions should investigate how changes in mitochondrial physiology might alter the ionic environment of the intermembrane space and thereby affect the formation of translocation contact sites through the TIM21-TOM22 interaction.

What are promising approaches for studying TIM21 interactions with other components of the protein import machinery?

Future research on TIM21 interactions could benefit from:

  • Comprehensive interaction mapping: Extending the peptide library and binding assays to identify other potential interaction partners beyond TOM22.

  • Cryo-electron microscopy: While X-ray crystallography provided high-resolution structural information about the TIM21 domain, cryo-EM could reveal how TIM21 is positioned within the larger context of the TIM23 complex and at translocation contact sites.

  • In vivo crosslinking: To capture transient interactions that might occur during different stages of protein import.

  • Single-molecule techniques: To understand the dynamics of TIM21 interactions during the protein import process.

  • Computational modeling: Molecular dynamics simulations could provide insights into the flexibility of the TIM21 structure and how it might adapt to different binding partners .

How might research on TIM21 inform our understanding of mitochondrial diseases?

While the search results don't explicitly address mitochondrial diseases, research on TIM21 has potential implications for understanding pathological conditions:

  • Protein import deficiencies: Since TIM21 plays a crucial role in connecting the TOM and TIM23 complexes, defects in TIM21 could potentially impact the efficiency of protein import into mitochondria, a process critical for mitochondrial function.

  • Translocation contact site disruptions: Abnormalities in the formation or stability of translocation contact sites could affect the import of specific subsets of mitochondrial proteins.

  • Therapeutic targeting: Understanding the structural basis of TIM21 interactions could potentially inform therapeutic approaches aimed at modulating mitochondrial protein import in disease states.

  • Biomarker development: Changes in TIM21 levels or post-translational modifications could potentially serve as biomarkers for certain mitochondrial dysfunction conditions.

Future research should investigate potential connections between TIM21 function and mitochondrial diseases, particularly those involving defects in protein import or inner membrane organization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.