Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2 (IMP2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Mitochondrial Inner Membrane Protease subunit 2 (IMP2) is a critical component of the mitochondrial inner membrane protease (IMP) complex found in the yeast Saccharomyces cerevisiae . The IMP complex is essential for the processing of proteins targeted to the mitochondrial inner membrane and intermembrane space . IMP2, along with IMP1, forms the catalytic core of this protease complex .

Role in Protein Processing

IMP is vital for the proteolytic processing of both mitochondrially and nucleus-encoded proteins during their export from the mitochondrial matrix into the inner membrane or the intermembrane space .

  • Presequence Translocase Assembly The inner membrane protease promotes the assembly of the presequence translocase, also known as the TIM23 complex, by removing a carboxy-terminal targeting sequence from proteins like Mgr2 .

  • Mgr2 Processing Mgr2, a small inner membrane protein, contains a carboxy-terminal extension that functions as a targeting sequence. IMP specifically cleaves this sequence, which is crucial for the proper assembly and function of the mitochondrial presequence translocase .

Research Findings and Mutational Analysis

Research involving mutational analysis and substrate modification has provided insights into the functions of various domains within IMP subunits .

  • Conserved Glycine Residues Certain conserved glycine residues in the second and third conserved regions of Imp1 and Imp2 are crucial for stabilizing the IMP complex and for the proteolytic activity of the subunits .

  • C-Terminal Regions The non-conserved C-terminal parts of the Imp subunits are essential for their proteolytic activities . The C-terminal region of Imp2, which includes a predicted second transmembrane segment, is not required for the stability of Imp2 and Imp1 and cannot functionally replace the C-terminal segment of Imp1 .

  • Substrate Specificity Modifying the Imp2 cleavage site in cytochrome c1 (from A/M to N/D) demonstrates the specificity of the Imp2 peptidase .

IMP Substrates

Besides its role in processing proteins with bipartite presequences, IMP also processes proteins with unconventional targeting signals .

  • Gut2 Identification Gut2, the mitochondrial FAD-dependent glycerol-3-phosphate dehydrogenase, has been identified as a new substrate for Imp1. Failure to cleave the Gut2 precursor may contribute to the respiratory-deficient phenotype (pet phenotype) observed in certain imp mutants .

  • Mgr2 as a Substrate Mgr2 carries a carboxy-terminal extension that functions as a targeting sequence and is selectively cleaved by IMP. This processing is essential for the proper assembly and function of the mitochondrial presequence translocase .

Clinical Significance and Relevance

While IMP2 is primarily studied in yeast, its human ortholog, IMMP2L, is also of interest due to its role in mitochondrial protein processing .

Techniques for Studying IMP2

Saccharomyces cerevisiae is a prime candidate for the expression of eukaryotic integral membrane proteins because it offers the convenience of using episomal expression plasmids, selection of positive transformants, post-translational modifications, and it can properly fold and target IMPs .

  • Expression Systems S. cerevisiae is often used for expressing eukaryotic integral membrane proteins, offering advantages such as episomal expression plasmids and proper protein folding and targeting .

  • Mutant Studies Analyzing inner membrane peptidase mutants helps in understanding the functions of various domains and the basis of substrate recognition .

  • Activity Assays Oxygen consumption assays can be used to test the inhibition of purified Mycobacterium smegmatis CIII2CIV2 by various compounds .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. For specific format requirements, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IMP2; YMR035W; YM9973.09; Mitochondrial inner membrane protease subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
IMP2
Target Protein Sequence
MFRAGSSKRFLRNTLIAISWVPVLLTINNNVVHIAQVKGTSMQPTLNPQTETLATDWVLL WKFGVKNPSNLSRDDIILFKAPTNPRKVYCKRVKGLPFDTIDTKFPYPKPQVNLPRGHIW VEGDNYFHSIDSNTFGPISSGLVIGKAITIVWPPSRWGTDLKLSTGRDCISKRAILE
Uniprot No.

Target Background

Function

Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2 (IMP2) is a catalytic component of the mitochondrial inner membrane peptidase (IMP) complex. This complex catalyzes the removal of signal peptides crucial for targeting proteins from the mitochondrial matrix, across the inner membrane, into the intermembrane space. The two catalytic IMP subunits exhibit non-overlapping substrate specificities. IMP2 substrates include nuclear-encoded CYB2, mitochondrially-encoded COX2, and cytochrome c1. IMP2 is essential for IMP1 stability.

Database Links

KEGG: sce:YMR035W

STRING: 4932.YMR035W

Protein Families
Peptidase S26 family, IMP2 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of IMP2 in Saccharomyces cerevisiae?

IMP2 in Saccharomyces cerevisiae serves as a transcriptional activator that mediates protection against DNA damage caused by oxidative stress. Research indicates that IMP2 prevents oxidative damage by regulating the expression of genes directly required to repair DNA damage . Additionally, IMP2 plays a crucial role in carbon metabolism regulation, specifically in the expression of glucose-repressible genes involved in alternative carbon source utilization pathways .

Methodologically, this dual function has been established through mutational analysis using deletion constructs, where imp2 null mutants displayed hypersensitivity to oxidants like bleomycin and hydrogen peroxide, while showing normal resistance to non-oxidative DNA damaging agents like UV light and methyl methane sulfonate . For carbon metabolism studies, researchers have employed strains with different deletions of the IMP2 coding sequence to analyze derepression patterns of glucose-repressible pathways .

How is IMP2 structurally characterized?

IMP2 contains distinctive structural domains that correlate with its functions. The protein features an acidic domain located at the N-terminus that enables its transcriptional activation capabilities. While it lacks a conventional DNA binding motif, IMP2 possesses a C-terminal leucine-rich repeat region that is critical for its functionality .

When studying IMP2 structure-function relationships, researchers typically employ targeted deletion constructs. For example, the delta T1 mutant (lacking the last 26 C-terminal amino acids) and the delta T2 mutant (completely lacking the coding region) have been used to assess how specific domains contribute to IMP2's regulatory functions . These experimental approaches have revealed that partial modification of the gene product sometimes yields more dramatic effects than its complete absence.

What experimental systems are most suitable for studying IMP2 function?

The most effective experimental system for studying IMP2 function is the Saccharomyces cerevisiae model with various genetic modifications. Researchers typically employ:

  • Gene knockout strains (imp2 null mutants)

  • Partial deletion mutants (e.g., delta T1 missing 26 C-terminal amino acids)

  • Complete deletion mutants (e.g., delta T2 lacking the entire coding region)

To assess DNA damage response, researchers expose wild-type and mutant strains to oxidants like bleomycin and hydrogen peroxide, followed by assessment of DNA strand breaks through techniques such as gel electrophoresis . For carbon metabolism studies, derepression assays are conducted by monitoring the expression and activity of enzymes such as maltase, invertase, alcohol dehydrogenase, and NAD-dependent glutamate dehydrogenase in response to glucose limitation .

What mechanisms underlie IMP2's role in oxidative stress response?

IMP2's role in oxidative stress response operates through a complex regulatory mechanism. When imp2 null mutants are exposed to oxidants like bleomycin or hydrogen peroxide, they accumulate strand breaks in chromosomal DNA that persist even after 6 hours post-challenge, unlike wild-type strains where damage is efficiently repaired . This suggests IMP2 regulates genes involved in DNA repair pathways specific to oxidative damage.

To investigate this mechanism, researchers should employ:

  • Chromatin immunoprecipitation (ChIP) to identify direct binding targets of IMP2

  • RNA-seq analysis comparing wild-type and imp2 mutant strains under oxidative stress

  • Time-course experiments measuring DNA damage and repair kinetics

  • Reporter gene assays using IMP2's acidic domain to confirm transcriptional activation function

These approaches can reveal the specific genes regulated by IMP2 and their temporal activation patterns during oxidative stress response.

How does IMP2 regulate glucose-repressible gene expression?

IMP2 exhibits a sophisticated regulatory mechanism for glucose-repressible gene expression, functioning as both a positive and negative regulator depending on the target pathway. For maltose, galactose, raffinose, and ethanol utilization pathways, IMP2 positively regulates derepression in response to glucose limitation . Conversely, for NAD-dependent glutamate dehydrogenase (NAD-GDH), IMP2 functions as a negative regulator, with higher enzyme levels observed in imp2 mutants than in wild-type strains .

Methodologically, this dual regulatory function can be investigated through:

  • Transcript quantification using RT-qPCR for pathway-specific genes in wild-type and mutant strains

  • Enzyme activity assays under various carbon source conditions

  • Promoter-reporter constructs to dissect regulatory elements responsive to IMP2

  • Protein-protein interaction studies to identify co-regulators

Research has demonstrated that IMP2 exerts its regulatory effects at the transcriptional level, particularly for galactose- and maltose-inducible genes, acting as a positive regulator of maltase, maltose permease, and galactose permease gene expression .

What is the relationship between IMP2 and mitochondrial function in cancer research?

Recent research has uncovered a critical connection between IMP2 and mitochondrial function in cancer contexts, particularly glioblastoma (GBM). IMP2 binds several mRNAs encoding mitochondrial respiratory chain complex subunits, revealing a novel mechanism for controlling mitochondrial biogenesis and bioenergetics . This function is especially relevant in gliomaspheres, which serve as a model for cancer stem cells.

A comprehensive RNA immunoprecipitation (RIP) analysis identified approximately 400 transcripts bound by IMP2, with significant overrepresentation of genes involved in mitochondrial function and oxidative phosphorylation (OXPHOS) . This binding appears to be functionally significant, as depletion of IMP2 decreased the expression of these mitochondrial protein-encoding mRNAs.

To investigate this relationship, researchers should employ:

  • Proximity ligation assays (PLA) to confirm specific RNA-protein interactions

  • Respiratory chain complex activity measurements in IMP2-depleted cells

  • Mitochondrial function assays (oxygen consumption, ATP production)

  • Co-immunoprecipitation studies to identify protein interaction partners

Interestingly, protein interaction studies have revealed that IMP2 associates with several subunits of Complex I of the mitochondrial respiratory chain, suggesting multiple mechanistic links to OXPHOS regulation .

How do IMP2 mutations impact mitochondrial protein export and assembly?

While the search results don't directly address IMP2 mutations and mitochondrial protein export, they provide insights into related mitochondrial inner membrane processes that may be relevant. For example, the mitochondrial inner membrane protein Mss2p is required for the export of the C-terminal domain of Cox2p (a subunit of cytochrome oxidase) through the inner membrane . This process involves recognition of the Cox2p C-tail in the matrix and promotion of its export.

When designing experiments to investigate potential roles of IMP2 in similar processes, researchers should consider:

  • Creating specific IMP2 domain mutants to identify regions involved in potential protein export functions

  • Employing pulse-chase labeling of mitochondrial translation products to assess protein stability and export

  • Using reporter constructs (such as ARG8) fused to mitochondrial proteins to track export processes

  • Analyzing mitochondrial respiratory complex assembly through blue native PAGE

These approaches can help determine whether IMP2 plays roles in mitochondrial protein export similar to those of other inner membrane proteins like Mss2p, Oxa1p, or Pnt1p.

What techniques are most effective for studying IMP2-RNA interactions?

To investigate IMP2-RNA interactions, researchers have successfully employed several complementary techniques:

  • RNA Immunoprecipitation (RIP): This approach involves immunoprecipitating IMP2 and analyzing bound RNAs. In studies of gliomaspheres, RIP identified approximately 400 transcripts bound by IMP2, with significant enrichment for those encoding mitochondrial proteins .

  • Proximity Ligation Assay (PLA): This technique confirms direct RNA-protein interactions in situ. For example, researchers have used PLA with biotin-labeled RNA oligomers of candidate IMP2 targets (such as COX7b) and visualized the interaction as fluorescent spots .

  • Quantitative RT-PCR validation: Following RIP, researchers should validate enrichment of selected transcripts in the IMP2-bound fraction by qRT-PCR .

  • Functional validation: To confirm biological relevance of RNA binding, researchers should assess how IMP2 depletion affects target transcript levels and corresponding protein expression .

This multi-technique approach provides robust evidence for specific RNA-protein interactions and their functional significance in cellular processes.

What are the best practices for generating and analyzing IMP2 mutants?

When generating and analyzing IMP2 mutants, researchers should consider the following best practices based on successful previous studies:

  • Create diverse mutation types: Generate both complete deletion mutants (null) and strategic partial deletions targeting specific domains. Studies have shown that partial modifications (like the delta T1 mutant lacking 26 C-terminal amino acids) can sometimes produce more dramatic effects than complete gene deletion (delta T2) .

  • Conduct comprehensive phenotypic characterization: Assess multiple phenotypic parameters, including:

    • Growth on different carbon sources

    • Sensitivity to oxidative stress agents

    • Enzymatic activities of regulated pathways

    • DNA damage and repair kinetics

    • Transcriptional profiles of target genes

  • Use appropriate controls: Always include wild-type strains cultured under identical conditions.

  • Perform complementation tests: Verify that phenotypes can be rescued by reintroducing the wild-type gene.

  • Consider combinatorial mutations: Create double mutants with genes in related pathways to identify genetic interactions.

These approaches ensure robust characterization of IMP2 function through mutational analysis.

How can researchers effectively measure the impact of IMP2 on oxidative phosphorylation?

To effectively measure IMP2's impact on oxidative phosphorylation (OXPHOS), researchers should employ multiple complementary approaches:

  • Respiratory chain complex activity assays: Measure the activities of individual respiratory chain complexes (I-V) in mitochondria isolated from wild-type and IMP2-depleted cells.

  • Oxygen consumption rate (OCR) measurements: Use platforms like Seahorse XF analyzers to assess cellular respiration parameters, including basal respiration, ATP production, maximal respiration, and spare respiratory capacity.

  • Mitochondrial membrane potential assessment: Employ fluorescent probes like TMRM or JC-1 to evaluate mitochondrial membrane potential as an indicator of OXPHOS efficiency.

  • ATP production assays: Quantify cellular ATP levels to determine energy production capacity.

  • Expression analysis of OXPHOS components: Monitor expression levels of nuclear-encoded OXPHOS components at both mRNA and protein levels following IMP2 manipulation.

  • Blue native PAGE: Assess the assembly status of respiratory chain supercomplexes to determine if IMP2 affects complex formation or stability.

This multi-parameter assessment provides comprehensive insights into how IMP2 influences mitochondrial bioenergetics and OXPHOS function.

How should researchers interpret seemingly contradictory roles of IMP2?

IMP2 demonstrates seemingly contradictory roles as both a transcriptional regulator and a potential modulator of mitochondrial function. To properly interpret these diverse functions, researchers should:

  • Consider cellular compartmentalization: Evaluate whether different pools of IMP2 exist in distinct cellular compartments (nucleus, cytoplasm, mitochondria) with compartment-specific functions.

  • Assess condition-specific activation: Determine if IMP2 switches between functions depending on cellular conditions (stress response vs. normal growth).

  • Analyze protein interaction networks: Map IMP2's interaction partners under different conditions to understand context-dependent function.

  • Employ temporal studies: Track IMP2 localization and activity over time to identify potential sequential functions.

  • Use domain-specific mutants: Create mutations targeting specific functional domains to dissect which regions are responsible for different activities.

Rather than viewing these diverse functions as contradictory, researchers should consider IMP2 as a multifunctional protein that coordinates nuclear gene expression with mitochondrial function, potentially serving as an integrator of cellular metabolism, stress response, and energy production.

What controls should be included when studying IMP2 in different experimental systems?

When studying IMP2 across different experimental systems, proper controls are essential for valid data interpretation:

  • Genetic controls:

    • Complete IMP2 knockout (negative control)

    • Wild-type IMP2 complementation (positive control)

    • Domain-specific mutants (to identify region-specific functions)

    • Isogenic background strains (to control for strain-specific effects)

  • Environmental controls:

    • Defined media composition with controlled carbon sources

    • Standardized oxidative stress induction protocols

    • Consistent growth conditions (temperature, pH, aeration)

    • Time-matched sampling for temporal studies

  • Technical controls:

    • For immunoprecipitation: IgG control pulldowns

    • For RNA binding: non-target RNA controls

    • For localization studies: compartment-specific markers

    • For transcriptional studies: housekeeping gene normalization

  • Cross-validation approaches:

    • Multiple independent techniques to confirm key findings

    • Different model systems to verify conserved functions

    • Independent biological and technical replicates

These comprehensive controls ensure that observed phenotypes are specifically attributable to IMP2 function rather than experimental artifacts or secondary effects.

What are the most promising areas for future IMP2 research in yeast and beyond?

Based on current understanding of IMP2 functions, several promising research directions emerge:

  • Integrated stress response coordination: Investigate how IMP2 potentially coordinates transcriptional responses to oxidative stress with mitochondrial function adjustments, potentially serving as a master regulator of cellular adaptation.

  • Evolutionary conservation of function: Explore whether IMP2 homologs in other organisms share similar dual functions in transcriptional regulation and mitochondrial processes, particularly in mammalian systems.

  • Role in metabolic switching: Examine how IMP2 facilitates transitions between fermentation and respiration during changing carbon source availability.

  • Post-translational modifications: Identify how phosphorylation, acetylation, or other modifications might regulate IMP2 function or localization under different cellular conditions.

  • Therapeutic targeting in cancer: Given IMP2's association with glioblastoma, investigate whether targeting IMP2 or its downstream pathways could provide novel therapeutic approaches for cancers dependent on oxidative phosphorylation.

  • Structural biology approaches: Determine the three-dimensional structure of IMP2, particularly focusing on RNA-binding domains and protein interaction surfaces to better understand molecular mechanisms.

These research directions offer potential for significant advances in understanding cellular stress responses, metabolic adaptation, and disease processes related to mitochondrial dysfunction.

What technical innovations would advance IMP2 research?

Several technical innovations could substantially advance IMP2 research:

  • CRISPR-based tracking systems: Employing CRISPR-based tagging to visualize IMP2 localization and dynamics in live cells in response to various stressors and metabolic conditions.

  • Proximity labeling approaches: Using BioID or APEX2 fusion proteins to identify the complete proximal proteome of IMP2 under different cellular conditions.

  • Single-cell analysis techniques: Applying single-cell transcriptomics and proteomics to understand cell-to-cell variability in IMP2 function and target gene expression.

  • Improved mitochondrial isolation methods: Developing techniques for rapid, pure isolation of functional mitochondria to better characterize IMP2's role in mitochondrial processes.

  • High-throughput mutagenesis: Implementing deep mutational scanning to comprehensively map functional domains and critical residues of IMP2.

  • Cryo-EM structural analysis: Utilizing cryo-electron microscopy to determine the structure of IMP2 in complex with its RNA targets and protein partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.