Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protein OXA1 (OXA1)

Shipped with Ice Packs
In Stock

Description

Definition and Recombinant Production

Recombinant OXA1 refers to the protein produced through heterologous expression systems like E. coli, yeast, or mammalian cells, retaining the functional domains critical for its role in mitochondrial membrane protein insertion. Key specifications include:

PropertyDetail
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (verified by SDS-PAGE)
Gene NameOXA1
Functional RegionsPartial sequences retaining membrane insertion activity

This recombinant form enables biochemical and structural studies without requiring native mitochondrial isolation.

Functional Roles of Native OXA1

OXA1 is essential for assembling mitochondrial OXPHOS complexes, including:

  • Cytochrome c oxidase (COX): Mediates cotranslational insertion of mitochondrially encoded subunits (Cox1, Cox2, Cox3) into the inner membrane .

  • F1_1Fo_o-ATP synthase: Facilitates posttranslational assembly of Atp9 oligomers into the Fo_o-sector, ensuring proper interaction with Atp6 .

  • Nuclear-encoded proteins: Inserts proteins like Mdl1 into the inner membrane .

OXA1 interacts with mitochondrial ribosomes via its C-terminal matrix domain, coupling translation to membrane insertion .

Ribosome Interaction

  • OXA1 cross-links with Mrp20 (L23 homolog) and MrpL40 (L24 homolog) near the ribosomal exit tunnel, ensuring nascent chain transfer during translation .

  • Truncation of OXA1’s C-terminal domain disrupts ribosome binding, impairing COX assembly .

ATP Synthase Assembly

  • OXA1 binds Atp9 posttranslationally, stabilizing its oligomerization before Atp6 incorporation .

  • Δoxa1 mutants show defective Fo_o-sector assembly but retain partial F1_1-sector activity .

Dynamic Localization

  • OXA1 redistributes between cristae membranes (CM) and inner boundary membranes (IBM) based on metabolic demands:

    • Respiratory conditions: Enriched in CM, dependent on mitochondrial translation .

    • Fermentable conditions: Shifts to IBM, requiring nuclear-encoded protein import .

Research Applications of Recombinant OXA1

Recombinant OXA1 is utilized to:

  1. Study membrane protein insertion mechanisms in vitro.

  2. Analyze interactions with ribosomal subunits (e.g., Mrp20, MrpL40) .

  3. Investigate structural determinants of its C-terminal ribosome-binding domain .

Evolutionary and Functional Conservation

OXA1 homologs exist in plants (e.g., Arabidopsis thaliana), fungi (e.g., Saccharomyces servazzii), and bacteria, underscoring its conserved role in energy-transducing membrane assembly .

Open Questions and Future Directions

  • Structural resolution of OXA1-ribosome complexes.

  • Elucidating posttranslational regulation of OXA1 in dual targeting (CM vs. IBM).

  • Engineering OXA1 variants for synthetic biology applications in mitochondrial therapeutics.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing the order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
OXA1; PET1402; YER154W; Mitochondrial inner membrane protein OXA1; Cytochrome oxidase biogenesis protein OXA1; Oxidase assembly protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
43-402
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
OXA1
Target Protein Sequence
NSTGPNANDVSEIQTQLPSIDELTSSAPSLSASTSDLIANTTQTVGELSSHIGYLNSIGL AQTWYWPSDIIQHVLEAVHVYSGLPWWGTIAATTILIRCLMFPLYVKSSDTVARNSHIKP ELDALNNKLMSTTDLQQGQLVAMQRKKLLSSHGIKNRWLAAPMLQIPIALGFFNALRHMA NYPVDGFANQGVAWFTDLTQADPYLGLQVITAAVFISFTRLGGETGAQQFSSPMKRLFTI LPIISIPATMNLSSAVVLYFAFNGAFSVLQTMILRNKWVRSKLKITEVAKPRTPIAGASP TENMGIFQSLKHNIQKARDQAERRQLMQDNEKKLQESFKEKRQNSKIKIVHKSNFINNKK
Uniprot No.

Target Background

Function
Oxa1, a mitochondrial inner membrane insertase, facilitates the insertion of both mitochondrion-encoded precursors and nuclear-encoded proteins into the inner membrane. It links mitoribosomes to the inner membrane and forms pores capable of accommodating translocating protein segments. Oxa1 is crucial for the activity and assembly of cytochrome c oxidase and plays a central role in the translocation and export of the N-terminal part of the COX2 protein into the mitochondrial intermembrane space.
Gene References Into Functions
  1. Observations suggest that the function of Oxa1 extends beyond the biogenesis of conserved mitochondrial components such as respiratory chain complexes or ABC transporters, encompassing mitochondria-specific membrane proteins of eukaryotic origin. PMID: 22846909
  2. The close proximity of Oxa1 to ribosomes not only enhances membrane insertion but is also critical for the productive assembly of cytochrome c oxidase subunits. PMID: 22904327
  3. Oxa1 functions as a pore-forming translocase regulated by membrane potential and substrate dependence. PMID: 22829595
  4. Findings indicate that the distribution of Oxa1 within the inner membrane is dynamic and adapts to different physiological needs. PMID: 22513091
  5. Deletion of OXA1 hinders the biogenesis of the three respiratory complexes of dual genetic origin. PMID: 15908145
  6. Oxa1 possesses the ability to accept preproteins within the membrane. PMID: 16253275
  7. The phosphatidylethanolamine level of yeast mitochondria is influenced by the mitochondrial components OXA1 and YME1. PMID: 17976194
  8. OXA1 complements a deficiency in yidC2 in S. mutans. PMID: 19366667

Show More

Hide All

Database Links

KEGG: sce:YER154W

STRING: 4932.YER154W

Protein Families
OXA1/ALB3/YidC family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the OXA1 protein and what is its role in yeast mitochondria?

OXA1 is a polytopic membrane protein belonging to the conserved Oxa1/YidC/Alb3 protein family that plays a crucial role in the biogenesis of respiratory and photosynthetic complexes in bacteria and organelles. In Saccharomyces cerevisiae, OXA1 mediates the co-translational insertion of mitochondrially encoded subunits of respiratory complexes III, IV, and V within the inner membrane . Additionally, OXA1 controls a late step in complex V assembly, making it essential for proper mitochondrial function . The protein facilitates the membrane insertion of both nuclearly and mitochondrially encoded proteins into the inner mitochondrial membrane, serving as a key component of the mitochondrial protein insertion machinery .

What is the structural organization of the OXA1 protein?

OXA1 is a polytopic protein embedded in the mitochondrial inner membrane. While no crystal structure is currently available for OXA1 or its bacterial homolog YidC , biochemical analyses have revealed that the protein contains multiple transmembrane segments (TMs) connected by hydrophilic loops. Particularly important are transmembrane segments TM4 and TM5, which appear to play key roles in the protein's function . The protein also features a matrix-exposed C-terminal region that extends into the mitochondrial matrix and plays a critical role in ribosome interaction . Functional studies using point mutations have demonstrated important interactions between TM2 and TM5, TM4 and TM5, as well as between TM4 and loop 2, highlighting the complex tertiary structure of this insertase .

How does OXA1 differ from its homologs in other organisms?

OXA1 belongs to the evolutionarily conserved Oxa1/YidC/Alb3 protein family found across bacteria and eukaryotic organelles . While these proteins share the core function of membrane protein insertion, the yeast mitochondrial OXA1 has specific adaptations for its role in the biogenesis of respiratory complexes. Unlike some bacterial homologs, OXA1 features a C-terminal extension that interacts with mitochondrial ribosomes, allowing for co-translational insertion of proteins . This ribosome-binding capability appears to be a specialized feature that enhances the coupling between translation and membrane insertion in mitochondria, a characteristic that may not be as pronounced in all family members across different species .

What are the most effective methods for expressing recombinant OXA1 protein?

For recombinant expression of S. cerevisiae OXA1, researchers typically employ heterologous expression systems optimized for membrane proteins. The most effective methodology includes:

  • Expression vector selection: Vectors containing strong inducible promoters (such as GAL1 for yeast expression) with appropriate purification tags (His6 or GST) positioned to avoid interference with protein function.

  • Expression host optimization: While E. coli systems can be used for simplified fragments, full-length functional OXA1 is best expressed in eukaryotic systems such as S. cerevisiae or insect cells that possess the machinery for proper membrane protein folding.

  • Membrane fraction isolation: Following expression, careful isolation of membrane fractions through differential centrifugation, followed by solubilization using mild detergents such as digitonin or n-dodecyl-β-D-maltoside (DDM) preserves protein structure and function .

  • Purification strategy: Affinity chromatography followed by size exclusion chromatography yields the highest purity samples for subsequent functional and structural studies.

For functional studies, complementation of oxa1 deletion strains with recombinant variants provides a powerful approach to assess protein function in vivo .

What techniques are most suitable for studying OXA1-ribosome interactions?

Several complementary techniques have proven valuable for investigating OXA1-ribosome interactions:

  • Sucrose gradient centrifugation: This technique allows for the analysis of co-sedimentation behavior of OXA1 with ribosomal components. Studies have shown that OXA1's sedimentation pattern changes in the presence or absence of ribosomes, indicating a physical association .

  • Chemical cross-linking: Cross-linking experiments have successfully demonstrated the proximity of OXA1 to ribosomal proteins, particularly Mrp20 (a homolog of ribosomal subunit L23 located near the peptide exit tunnel) . The cross-linking approach typically employs reagents like DSP (dithiobis(succinimidyl propionate)) followed by immunoprecipitation with specific antibodies.

  • Ribosome dissociation experiments: Studying OXA1 sedimentation behavior under conditions that dissociate ribosomal subunits (e.g., in the presence of EDTA) has revealed specific association with the large ribosomal subunit .

  • C-terminal truncation analysis: Functional studies with C-terminal truncated OXA1 variants have demonstrated the importance of this region in ribosome binding, providing an indirect but valuable approach to study these interactions .

What approaches can be used to investigate OXA1's role in membrane protein insertion?

To investigate OXA1's membrane insertion function, researchers employ:

  • In vivo pulse-chase experiments: Radiolabeling newly synthesized mitochondrial proteins followed by immunoprecipitation allows tracking of membrane insertion kinetics for substrates like Cox1, Cox2, and Cox3 .

  • In organello protein synthesis: Isolated mitochondria can be used for protein synthesis experiments to study insertion of newly translated proteins into the inner membrane in the presence of wild-type or mutant OXA1 .

  • Blue native PAGE analysis: This technique enables visualization of assembled respiratory complexes, allowing researchers to assess the impact of OXA1 mutations on complex formation .

  • Site-directed mutagenesis: Creating point mutations in different domains of OXA1 has revealed functional interactions between transmembrane segments (particularly TM2-TM5 and TM4-TM5) and their impact on respiratory complex assembly .

  • Second-site suppressor screening: Isolation of revertants carrying compensatory mutations that restore respiration has been valuable for identifying functional interactions within the OXA1 protein structure .

How does the C-terminal domain of OXA1 facilitate interaction with mitochondrial ribosomes?

The C-terminal domain of OXA1 plays a crucial role in facilitating interactions with mitochondrial ribosomes through several mechanisms:

  • Electrostatic interactions: The C-terminal region of OXA1 is rich in positively charged amino acids, creating a basic domain that likely interacts with the negatively charged rRNA components of the large ribosomal subunit .

  • Specific ribosomal protein contacts: Cross-linking studies have demonstrated that OXA1 can be specifically cross-linked to Mrp20, a component of the large ribosomal subunit homologous to L23 . L23 is strategically located adjacent to the peptide exit tunnel of the ribosome, positioning OXA1 perfectly to receive nascent polypeptide chains as they emerge .

  • Functional significance: Truncation of the C-terminal segment significantly compromises OXA1's ability to support insertion of substrate proteins into the inner membrane. Yeast strains expressing C-terminal truncated OXA1 display temperature-sensitive growth phenotypes on non-fermentable carbon sources, indicating impaired respiratory function .

  • Co-translational insertion coupling: The interaction between the C-terminal domain and ribosomes is believed to enhance the coupling between translation and membrane insertion events, creating an efficient pathway for integrating mitochondrially encoded proteins into the inner membrane .

What is the differential impact of OXA1 mutations on respiratory complexes III, IV, and V?

Mutational analysis of OXA1 has revealed complex-specific effects on the biogenesis of respiratory chain complexes:

Mutation LocationEffect on Complex IIIEffect on Complex IVEffect on Complex VReference
TM2 mutationsModerate impairmentSevere impairmentVariable effects
TM4 mutationsMild impairmentModerate impairmentStrong impairment
TM5 mutationsSevere impairmentSevere impairmentSevere impairment
Loop 2 mutationsMild effectModerate impairmentStrong impairment
C-terminal truncationModerate effectSevere effect (Cox1/Cox2 insertion defects)Severe assembly defects

These differential effects suggest that OXA1 may utilize distinct structural features or mechanisms when facilitating the insertion of different substrate proteins. Complex V (ATP synthase) appears particularly sensitive to mutations in multiple domains of OXA1, possibly reflecting a more specialized role for OXA1 in ATP synthase assembly beyond simple membrane insertion of subunits .

How do functional interactions between OXA1 transmembrane domains contribute to protein function?

Mutational analysis and second-site suppressor studies have revealed critical functional interactions between transmembrane domains of OXA1:

  • TM2-TM5 interactions: These transmembrane segments appear to interact functionally, as mutations in TM5 can be suppressed by compensatory mutations in TM2 . This suggests these helices form part of a coordinated structural unit within the protein.

  • TM4-TM5 interactions: Similarly, functional interactions between TM4 and TM5 have been demonstrated through revertant analysis, where mutations in one segment can compensate for mutations in the other .

  • TM4-Loop 2 interactions: Cross-talk between transmembrane segment 4 and the hydrophilic loop 2 suggests that the arrangement of membrane-spanning and soluble domains is critical for OXA1 function .

These interactions likely create a dynamic structure that can adapt to different substrate proteins, facilitating their insertion into the membrane. The functional data indicates that TM4 and TM5 occupy key positions within the OXA1 protein structure, potentially forming part of the substrate-conducting channel or interaction interface .

What are the main challenges in purifying functional recombinant OXA1 protein?

Purification of functional recombinant OXA1 presents several significant challenges:

  • Membrane protein solubilization: As a polytopic membrane protein with multiple transmembrane segments, OXA1 requires careful selection of detergents that can extract the protein from membranes while maintaining its native conformation. Detergents like digitonin and DDM preserve protein-protein interactions better than harsher detergents like SDS or Triton X-100.

  • Maintaining structural integrity: The functional interactions between transmembrane domains (TM2-TM5, TM4-TM5, TM4-Loop 2) are critical for proper protein function . Purification conditions must preserve these interactions to obtain functionally relevant protein.

  • Ribosome association: For studying co-translational insertion, maintaining the association between OXA1 and the ribosome during purification requires specialized approaches, such as cross-linking or gradient ultracentrifugation in the presence of appropriate stabilizing agents .

  • Reconstitution for functional studies: Assessing OXA1 function often requires reconstitution into liposomes or nanodiscs to provide a membrane environment, adding complexity to experimental protocols.

How can researchers distinguish between direct and indirect effects of OXA1 mutations on respiratory complex assembly?

Distinguishing direct from indirect effects of OXA1 mutations requires a multifaceted approach:

  • Sequential assembly analysis: Tracking the formation of sub-complexes and intermediates during respiratory complex assembly helps determine the precise step affected by OXA1 mutations. This can be achieved through blue native PAGE combined with pulse-chase experiments.

  • Substrate-specific insertion assays: Direct measurement of the insertion efficiency for specific OXA1 substrates (e.g., Cox1, Cox2, Cox3) can identify primary defects in membrane insertion versus secondary assembly problems .

  • Ribosome interaction studies: Assessing whether mutations affect ribosome binding (through techniques described in section 2.2) helps determine if observed phenotypes stem from disrupted co-translational insertion or later assembly steps .

  • Suppressor analysis: Second-site suppressor screening is particularly valuable for establishing causality. When a compensatory mutation in another protein or another domain of OXA1 rescues function, it provides strong evidence for a specific functional interaction rather than general structural disruption .

  • Comparative analysis across complexes: Since OXA1 affects multiple respiratory complexes, comparing the pattern of defects across complexes III, IV, and V can help distinguish general insertion defects from complex-specific assembly roles .

What strategies can overcome limitations in structural studies of OXA1 and its membrane protein substrates?

Given the absence of crystal structures for OXA1 , researchers can employ alternative approaches:

  • Cryo-electron microscopy: Recent advances in cryo-EM have revolutionized membrane protein structural biology, potentially allowing visualization of OXA1 alone or in complex with ribosomes and/or substrate proteins.

  • Cross-linking mass spectrometry (XL-MS): This approach can map proximity relationships between different regions of OXA1, as well as between OXA1 and interaction partners, providing constraints for structural modeling.

  • Evolutionary coupling analysis: Analyzing patterns of co-evolution in sequence alignments can predict contacts between amino acid residues, generating testable structural models.

  • Site-directed spin labeling and EPR spectroscopy: This technique can provide distance constraints between specific sites within the protein, helping to validate structural models.

  • Integrative structural biology: Combining low-resolution structural data with computational modeling and functional constraints from mutagenesis studies can generate informative structural models in the absence of high-resolution structures.

  • Homology modeling: While no crystal structure exists for OXA1 or YidC , structural information from distantly related proteins can provide initial models that can be refined with experimental data.

How might the co-translational insertion mechanism of OXA1 be leveraged for biotechnological applications?

The co-translational insertion mechanism of OXA1 offers several promising biotechnological applications:

  • Improved membrane protein expression systems: Engineered expression systems incorporating OXA1 or its domains could enhance the production of difficult-to-express membrane proteins for structural and functional studies.

  • Design of artificial insertases: Understanding the principles of OXA1-mediated insertion could inform the design of synthetic insertases with customized substrate specificity for biotechnology applications.

  • Mitochondrial protein delivery systems: OXA1's ability to recognize and insert specific proteins could be adapted to create targeted delivery systems for therapeutic proteins into mitochondria, potentially addressing mitochondrial disorders.

  • Biosensor development: OXA1's ability to couple translation to membrane insertion could be engineered into biosensor systems where protein insertion triggers detectable signals, useful for monitoring cellular processes or detecting specific molecules.

What are the most promising approaches for investigating substrate specificity of OXA1?

Understanding the substrate specificity of OXA1 requires sophisticated experimental approaches:

  • Systematic substrate variant testing: Creating libraries of substrate protein variants with mutations in key regions can help identify the sequence and structural features recognized by OXA1.

  • Chimeric protein analysis: Constructing chimeric proteins that combine segments from OXA1 substrates and non-substrates can pinpoint recognition elements.

  • Cross-linking and mass spectrometry: Capturing transient interactions between OXA1 and substrate proteins during insertion can identify contact points and recognition interfaces.

  • Ribosome nascent chain complexes (RNCs): Generating stalled RNCs with nascent OXA1 substrates at different stages of synthesis can reveal how co-translational recognition occurs.

  • In vitro reconstitution systems: Developing purified systems with OXA1 reconstituted into liposomes or nanodiscs allows controlled testing of substrate insertion under defined conditions.

  • Comparative analysis across species: Examining how substrate specificity varies across OXA1 homologs from different organisms can reveal conserved recognition principles.

How does OXA1 coordinate with other mitochondrial protein insertion pathways?

The coordination between OXA1 and other mitochondrial protein insertion pathways represents a complex and critical area of research:

  • Interaction with the TIM23 complex: For proteins with complex topology, OXA1 may work in conjunction with the TIM23 complex, which mediates import of proteins from the cytosol. Understanding this coordination requires experiments that track the fate of specific substrates through both pathways.

  • Relationship with the conservative sorting pathway: Some proteins follow a "conservative sorting pathway" where they are first imported into the matrix before being inserted into the inner membrane. OXA1's role in this pathway and how it coordinates with matrix chaperones remains an active area of investigation.

  • Cooperation with assembly factors: Beyond insertion, OXA1 appears to play roles in the assembly of respiratory complexes, particularly complex V . Investigating how OXA1 coordinates with dedicated assembly factors for each complex will provide insights into the broader assembly network.

  • Temporal coordination: Research into the timing of translation, membrane insertion, and assembly events could reveal regulatory mechanisms that ensure proper coordination between these processes, potentially involving post-translational modifications of OXA1 or its interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.