Recombinant Saccharomyces cerevisiae Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Mitochondrial Intermembrane Space Import and Assembly Protein 40 (MIA40)

Mitochondrial intermembrane space import and assembly protein 40 (MIA40), is a protein crucial for the import and oxidative folding of proteins within the mitochondrial intermembrane space (IMS) . It is essential for the biogenesis of the respiratory chain and maintaining mitochondrial function .

Mechanism of Action

MIA40 facilitates the import of cysteine-containing proteins into the mitochondrial intermembrane space via cysteine-dependent oxidative folding . A nine-amino acid intermembrane-targeting signal (ITS) guides the active cysteine of substrate proteins to dock with MIA40 oxidase for folding and import into the mitochondria .

The interaction between MIA40 and substrate proteins involves the recognition of internal targeting signals, known as MISS or ITS sequences, within the substrate . These sequences dock onto the substrate-binding region of MIA40, facilitating interaction between cysteine residues and the redox-active cysteine pair in MIA40 .

Role as a Trans-Site Receptor

MIA40 functions primarily as a trans-site receptor, where its substrate-binding domain drives protein translocation across the outer mitochondrial membrane . The binding of MIA40 to incoming proteins via hydrophobic interactions mediates this translocation, suggesting a 'holding trap' mechanism rather than a 'folding trap' model .

Influence on Apoptosis-Inducing Factor 1 (AIFM1)

Recent studies suggest that MIA40 interacts with apoptosis-inducing factor 1 (AIFM1), suppressing AIFM1-induced cell death . MIA40 forms an interaction interface with AIFM1, which involves the N-terminal domain of MIA40 binding underneath the C-loop of AIFM1, resulting in the formation of an extended $$\beta$$-sheet with AIFM1's C-terminal domain . This interaction stabilizes the AIFM1 dimer, potentially inhibiting AIFM1's nuclear translocation and subsequent cell death activity .

Impact on Complex I Biogenesis

MIA40 is crucial for importing subunits of complex I, such as NDUFS5, NDUFB7, and NDUFA8 . An increase in the NADH/NAD+ balance enhances the AIFM1-MIA40 interaction, possibly improving MIA40 pathway efficiency to recover complex I biogenesis and the reorganization of cellular metabolism .

MIA40 and PolyQ Aggregation

Increased levels of MIA40 can prevent the aggregation of polyQ proteins in the cytosol .

MIA40's Chaperone Function

MIA40 functions as a molecular chaperone, inducing the folding of the ITS within its substrate . This folding action on the targeting signal initiates the complete folding of the substrate, which is usually a highly cooperative process .

MIA40 in Mitochondrial Protein Import and Assembly

MIA40 plays an essential role in the import and assembly of mitochondrial proteins, particularly small Tim proteins . The binding of these Tim proteins to MIA40 is crucial for their transport across the outer membrane, which represents an initial step in their assembly into the IMS complexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
MIA40; TIM40; YKL195W; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-403
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MIA40
Target Protein Sequence
MASSPQFGRNSNQEKTAGFIMGILSMAGALYFIAPNRKPLFASRKVESDKTAEEELSSGG EQSPENEDDNNSKSDENGDDNDSKNDETEAGPQLGGDKIGASKVAEDGELVVLAEEDNKS SEDKDTDESKVSTKDDEQSNEDNATANNQKDENISSENSEENTSDKTLDNNAGSSEKKDP EHSDDEKSQQGQSDDKTTTEDNNGEEESSKKTVSDSENSAKQSESSDEEKEELRKQEEKQ MGPTEEEVQHEGAYNPDTGEINWDCPCLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCV EKFQHMQDCFRKYPEHYAEQLKETSDDEEPQDKVKVNTIESAPNVSSAKENAAKKAEQSD VKKEPLNEESKP
Uniprot No.

Target Background

Function
MIA40 (Mitochondrial intermembrane space import and assembly protein 40) is crucial for the import and folding of small, cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). It functions in a redox cycle with ERV1, involving a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state. Oxidized MIA40 forms a transient disulfide bridge with the reduced precursor, oxidizing it to facilitate intramolecular disulfide bond formation and subsequent folding within the IMS. ERV1 then reoxidizes the reduced MIA40.
Gene References Into Functions
  1. A study investigated whether parasite Erv homologs could substitute for Mia40; however, neither the KISS domain nor other truncated or mutant LtErv constructs rescued ScMia40-deficient yeast cells. PMID: 29310075
  2. Plant Erv1, unlike its counterparts in fungi and animals, independently promotes protein import and oxidative folding in the IMS, without Mia40. PMID: 29117860
  3. Research indicates that Mia40's substrate-binding domain is both necessary and sufficient for promoting protein import, suggesting that Mia40-mediated trapping drives translocation. PMID: 27343349
  4. Mia40 catalyzes the oxidative folding of disulfide-containing proteins within mitochondria. PMID: 24407114
  5. Mia40's role in mitochondrial oxidative protein folding and import has been extensively studied. PMID: 24983157
  6. Evidence suggests Mia40 functions as both a thiol oxidase and a disulfide reductase/isomerase. PMID: 25451030
  7. Mia40 oxidizes Mrp10 during its mitochondrial import. PMID: 24360785
  8. Saccharomyces cerevisiae Mia40 is an iron-sulfur protein located in the mitochondria. PMID: 23834247
  9. Atp23 is identified as a novel Mia40 substrate. Its oxidation is not essential for import; even a cysteine-to-serine mutant accumulates in mitochondria in a Mia40-dependent manner. PMID: 22990235
  10. Mitochondrial intermembrane space glutathione redox potential is linked to the cytosol, influencing Mia40's redox state. PMID: 22705944
  11. Mia40 regulates the oxidative folding of domain I of the copper chaperone Ccs1, impacting Ccs1 cellular distribution and Superoxide dismutase 1 (Sod1) activity. PMID: 21865594
  12. The 9-amino acid mitochondrial intermembrane space-targeting signal (ITS) involved in Mia40 docking has been characterized. PMID: 20026652
  13. Mia40 is a key component of a specific translocation pathway for metal-binding intermembrane space proteins. PMID: 15620710
  14. Mia40 acts as a trans receptor in the biogenesis of the Tim9-Tim10 chaperone complex in mitochondria. PMID: 17553782
  15. Oxidative folding of Tim9 and Tim10 is mediated by site-specific docking onto Mia40 in the IMS. PMID: 17680986
  16. Studies have analyzed how mitochondrial biogenesis alters the sorting pathway of the intermembrane space receptor Mia40. PMID: 18779329
  17. Hot13, a conserved zinc-binding protein, interacts functionally and physically with Mia40, enhancing Erv1-dependent Mia40 oxidation in vivo and in vitro. PMID: 18787558
  18. Mia40 cysteine residues have distinct and unequally important roles in its function. PMID: 19011240
  19. Results align with growth phenotypes observed in Mia40 mutant cells with serine substitutions for conserved cysteine residues. PMID: 19667201
Database Links

KEGG: sce:YKL195W

STRING: 4932.YKL195W

Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What are the key structural features of Saccharomyces cerevisiae Mia40?

S. cerevisiae Mia40 contains two essential functional elements:

  • An N-terminal redox-active cysteine-proline-cysteine (CPC) motif critical for substrate oxidation

  • A C-terminal hydrophobic substrate-binding pocket for interaction with incoming proteins

The protein contains six conserved cysteine residues forming three disulfide bonds: the redox-active C1-C2 pair within the CPC motif, and two structural disulfides (C3-C6 and C4-C5) that stabilize the hydrophobic substrate-binding domain . Full-length yeast Mia40 also possesses an N-terminal bipartite presequence that targets it to mitochondria, although this element is absent in metazoan and plant homologs .

What is the primary function of Mia40 in mitochondria?

Mia40 serves dual functions as both a receptor and an oxidase in the mitochondrial IMS:

  • As a trans-site receptor, it binds incoming precursor proteins via hydrophobic interactions, driving their translocation across the outer membrane through a "holding trap" mechanism

  • As an oxidase, it introduces disulfide bonds into substrate proteins, promoting their oxidative folding and stable retention in the IMS

Genetic studies using Mia40 variants with mutations in either the CPC motif or the substrate-binding domain have demonstrated that the receptor function (substrate binding) is both necessary and sufficient for protein import, whereas the oxidase activity is essential for subsequent protein folding and stability .

What expression systems are recommended for producing recombinant S. cerevisiae Mia40?

For recombinant expression of S. cerevisiae Mia40, the following approaches have proven successful:

E. coli expression system:

  • Expression constructs typically use His-tagged versions of Mia40, particularly Mia40core (lacking the N-terminal 70-225 residues)

  • Expression in E. coli can be performed using pN-His10-Mia40Δ1-225 vectors with standard IPTG induction

Yeast expression system:

  • Endogenous promoter-driven expression using pFL39-derived plasmids

  • Galactose-inducible overexpression using GAL promoters, which allows for controlled high-level expression

Purification typically involves:

  • Affinity chromatography using Ni-NTA resins for His-tagged versions

  • Size exclusion chromatography to achieve high purity

  • Maintaining reducing conditions during initial purification steps if the functional redox-active form is desired

How can I assess the oxidation state of purified recombinant Mia40?

The oxidation state of Mia40 can be determined using the following methodology:

  • Alkylation assay with maleimide reagents:

    • Precipitate proteins with trichloroacetic acid (TCA) to preserve redox state

    • Treat with alkylating agents like mmPEG24 or mmPEG12

    • Analyze by SDS-PAGE to detect mass shifts (approximately 1.2 kDa per alkylated thiol for mmPEG24 and 0.7 kDa for mmPEG12)

  • Mobility shift analysis:

    • Compare migration patterns under reducing versus non-reducing SDS-PAGE

    • Fully oxidized Mia40 migrates faster under non-reducing conditions

    • Different redox states can be identified based on distinct band patterns

The oxidation state analysis typically reveals:

  • Two structural disulfides of the substrate-binding domain (C3-C6 and C4-C5)

  • Variable oxidation states of the CPC motif (C1-C2), which cycles between oxidized and reduced forms during its functional cycle

What are the key assays to evaluate Mia40's import function in isolated mitochondria?

Several complementary approaches can be used to assess Mia40's functionality:

In vitro import assays with radiolabeled substrates:

  • Generate 35S-labeled precursor proteins (Tim9, Tim10, Cox17, Cox19)

  • Incubate with isolated mitochondria (50-75 μg) at 30°C

  • Remove non-imported material by proteinase K treatment (50 μg/ml)

  • Analyze by SDS-PAGE under reducing and non-reducing conditions

Tracking covalent intermediates:

  • After import, solubilize mitochondria in detergent buffer with 50 mM iodoacetamide

  • Analyze mixed disulfide intermediates by blue native electrophoresis or SDS-PAGE

  • Verify Mia40 involvement through antibody shift assays using anti-Mia40 antibodies

Reconstitution with purified components:

  • Purify recombinant Mia40core with His10 tag

  • Reduce with 50 mM DTT and denature in 8 M urea

  • Import into isolated mitochondria (50-75 μg protein with 1.25-2.5 μg Mia40core)

  • Assess import efficiency by immunodecoration and Ni-NTA affinity purification

How can I monitor the oxidative folding pathway mediated by Mia40?

To track the oxidative folding pathway:

  • Pulse-chase oxidation kinetics:

    • Radiolabel translation products in yeast cells for 3 minutes

    • Stop labeling by washing cells and adding excess non-radioactive methionine

    • Take samples at different time points and treat with alkylating agent (mmPEG24)

    • Immunoprecipitate substrate proteins and analyze by SDS-PAGE

    • This reveals temporal progression of disulfide bond formation

  • Substrate intermediate trapping:

    • Import radiolabeled substrates in the presence of oxidizing agent CuCl2

    • Analyze by BN-PAGE to detect Mia40-substrate intermediates

    • Confirm identity using antibody-shift BN-PAGE with anti-Mia40 antibodies

In wild-type cells, substrates like Cox19 show complete oxidation within 2 minutes, while temperature-sensitive mia40 mutants exhibit significantly slower oxidation kinetics (4-8 minutes for half-oxidation) .

What are the most informative Mia40 mutants for dissecting its dual functionality?

Several key mutants have been instrumental in understanding Mia40's functions:

MutantDescriptionFunctional ImpactViabilityReference
Mia40-SPSCPC motif mutated to SPSLacks oxidase activity but maintains substrate bindingNot viable alone; partial rescue with diamide
Mia40-FEF315E/F318E mutations in binding pocketDisrupts substrate bindingNot viable
Mia40coreLacks N-terminal domain (residues 1-225)Fully functional core domainViable
mia40-3, mia40-4Temperature-sensitive mutantsConditional defects in import and oxidationViable at permissive temperature
C3S, C6S mutationsDisrupts C3-C6 disulfideAffects interaction with Erv1Dominant negative when overexpressed

For dissecting the receptor function from oxidase activity, the Mia40-SPS mutant is particularly valuable as it retains only the substrate-binding capability, demonstrating that the binding function alone can partially support protein import .

How can genetic complementation approaches be used to study Mia40 function?

Genetic complementation strategies:

  • Plasmid shuffling method:

    • Start with a strain harboring chromosomal deletion of MIA40 rescued by a URA3-containing plasmid expressing wild-type Mia40

    • Transform with test plasmids expressing Mia40 variants

    • Select on 5-FOA medium to counter-select against the URA3 plasmid

    • Assess growth to determine if the variant complements essential Mia40 function

  • Heterologous complementation:

    • Human MIA40 can complement yeast mia40 deletion despite lacking the presequence

    • Chimeric constructs combining cytochrome b2 presequence with Mia40core demonstrate importance of targeting signals

  • Temperature-sensitive complementation:

    • Use conditional mia40 mutants (mia40-3, mia40-4) grown at non-permissive temperature

    • Express Mia40 variants and assess rescue capacity

    • Measure mitochondrial protein levels to determine functionality

The complementation studies revealed that the C-terminal domain contains the essential functional elements of Mia40, and that the protein contains dual targeting information that can direct it to either the presequence pathway or the MIA pathway .

How does Mia40 cooperate with Erv1 to ensure complete oxidation of substrate proteins?

Mia40 and Erv1 cooperation involves a complex mechanism:

  • Ternary complex formation:

    • Mia40 initially engages with incoming substrates via its CPC motif

    • Erv1 subsequently binds to the Mia40-substrate conjugate at a site distinct from the C2 region

    • This forms a ternary complex (Mia40-substrate-Erv1) essential for complete oxidation

  • Electron transfer cascade:

    • A total of four electrons from substrate dithiols are accepted in consecutive steps

    • The redox-active CPC motif of Mia40 accepts electrons from the substrate

    • Erv1 reoxidizes the CPC motif, transferring electrons to cytochrome c or O2

Experimental approach to study the ternary complex:

  • Import saturating amounts of substrates into mitochondria

  • Perform affinity purification from detergent-solubilized mitochondria

  • Analyze binding partners by Western blotting or mass spectrometry

  • Compare wild-type and erv1 mutant (erv1-2, erv1-5) backgrounds

Experiments with temperature-sensitive erv1-2 mutants demonstrated that under restrictive conditions, Mia40 adopts a partially reduced form and fails to bind substrates, confirming the essential role of Erv1 in maintaining functional Mia40 .

What is the mechanism by which Mia40 achieves substrate specificity?

Mia40 achieves substrate specificity through a two-step "sliding-and-docking" mechanism:

  • Initial recognition via ITS/MISS signals:

    • Substrates contain a 9-amino acid internal peptide sequence called IMS-targeting signal (ITS) or mitochondrial IMS sorting signal (MISS)

    • The ITS forms an amphipathic helix with crucial hydrophobic residues positioned one or two turns away from the docking cysteine

  • Precise positioning of substrate cysteines:

    • Hydrophobic interactions between the ITS/MISS motif and Mia40's substrate-binding cleft orient the substrate noncovalently

    • This positions specific substrate cysteines to interact with Mia40's redox-active CPC motif

The specificity mechanism can be studied by:

  • Mutational analysis of the ITS/MISS regions in substrate proteins

  • NMR structure determination of Mia40-substrate complexes

  • Measuring binding affinities of Mia40 with wild-type and mutant substrates using surface plasmon resonance or isothermal titration calorimetry

This mechanism explains how Mia40 can selectively target different cysteines in different substrates (e.g., N-terminal cysteines in small Tims versus inner disulfide cysteines in Cox17) .

How does Mia40 overexpression affect cellular proteostasis beyond mitochondrial protein import?

Recent research has uncovered unexpected roles for Mia40 in cellular proteostasis:

  • Suppression of cytosolic protein aggregation:

    • Overexpression of Mia40 strongly protects cells against toxic protein aggregates like polyQ-GFP

    • This protective effect extends to both yeast and human cells

    • Mia40 prevents the formation of SDS-resistant aggregates and promotes homogeneous distribution of aggregation-prone proteins

  • Competition mechanism for cellular quality control resources:

    • Mitochondrial precursor protein import competes with aggregation-prone cytosolic proteins for chaperones and proteasome capacity

    • Mia40 regulates this competition as it has a rate-limiting role in mitochondrial protein import

    • Temperature-sensitive mia40 mutants show hypersensitivity to polyQ expression even at permissive conditions

  • Experimental approaches to study this phenomenon:

    • Co-expression of Mia40 with aggregation-prone reporter proteins

    • Fluorescence microscopy to track aggregate formation

    • Biochemical fractionation to measure soluble versus insoluble protein distribution

    • Cell growth assays to quantify toxicity suppression

The data reveal that endogenous Mia40 levels are rate-limiting under physiological conditions, as overexpression leads to significantly higher levels of many Mia40 substrates .

What are common problems encountered when expressing and purifying functional recombinant Mia40?

ProblemPossible CausesSolutions
Low expression yieldToxicity of oxidoreductase activityUse oxidase-deficient CPC→SPS mutant; Express as inclusion bodies and refold
Incorrect foldingImproper formation of structural disulfidesInclude oxidizing environment during purification; Co-express with Erv1
Aggregation during purificationExposed hydrophobic substrate-binding surfaceAdd mild detergents (0.1% Triton X-100); Maintain low protein concentration
Loss of activityReduction of the active site CPC motifAdd oxidizing agents like diamide or copper during final purification steps
Proteolytic degradationSensitivity of flexible regionsInclude protease inhibitors; Remove N-terminal region to express stable Mia40core

When purifying Mia40 for functional studies, it's critical to verify the oxidation state of the protein using alkylation assays with mmPEG reagents to confirm proper formation of both the structural disulfides and the redox-active CPC motif .

How can I distinguish between import and oxidation defects when characterizing Mia40 variants?

Distinguishing between these functions requires multiple complementary approaches:

  • Analysis with oxidase-deficient mutants:

    • Compare Mia40-SPS (lacks oxidase activity) with wild-type Mia40

    • Measure substrate accumulation in mitochondria

    • If Mia40-SPS supports import but not oxidation, defects in oxidation can be isolated

  • Chemical complementation approach:

    • Supplement with chemical oxidants like diamide

    • If defects are due to oxidation function, diamide should partially rescue the phenotype

  • Substrate-specific analysis:

    • Track early binding intermediates via BN-PAGE

    • Monitor formation of mature oxidized forms under non-reducing conditions

    • Compare kinetics of various steps in the pathway

  • Pulse-chase experiments:

    • Radiolabel substrates and follow oxidation over time

    • Compare wild-type and mutant conditions

    • Slower oxidation with normal initial binding indicates specific oxidation defects

A key finding from such analyses is that protein import driven by Mia40's receptor function occurs independently of its oxidase activity, as demonstrated by the partial restoration of IMS import in the Mia40-SPS mutant .

How has the Mia40 system evolved across different eukaryotic lineages?

The Mia40 system shows notable evolutionary variation:

  • Structural differences across lineages:

    • Fungal Mia40: Contains large N-terminal region with presequence

    • Metazoan and plant Mia40: Consists only of conserved C-terminal domain

    • The C-terminal domain with twin CX9C motifs is universally conserved

  • Targeting pathway evolution:

    • Fungal Mia40: Typically uses presequence pathway for import

    • Human MIA40: Lacks presequence, imported via the MIA pathway itself

    • Yeast Mia40core: Can use the MIA pathway, demonstrating evolutionary flexibility

  • Mechanistic variation in plants:

    • In Arabidopsis, Mia40 is not essential

    • Plant Erv1 can directly interact with and oxidatively fold substrate proteins

    • This indicates stepwise evolution of the IMS disulfide relay system

This evolutionary perspective suggests that the mitochondrial disulfide relay system evolved from a simple Erv1-only system to the more complex Mia40-Erv1 system seen in fungi and animals, with plants maintaining an intermediate state .

What is known about the substrate specificity of Mia40 across different species?

Substrate specificity features across species:

  • Conserved recognition elements:

    • The MISS/ITS motif (mitochondrial intermembrane space sorting signal/intermembrane space targeting signal) is broadly conserved

    • Hydrophobic substrate-binding cleft of Mia40 is structurally preserved across species

  • Species-specific differences:

    • Human Mia40 (CHCHD4) shows preference for oxidizing the inner disulfide of Cox17

    • Yeast Mia40 preferentially oxidizes the outer disulfide of Cox17

    • These differences correlate with evolutionary changes in substrate sequences

  • Methodological approaches for comparative studies:

    • Heterologous complementation (e.g., human MIA40 in yeast)

    • In vitro import assays with substrates and Mia40 from different species

    • Structural studies of Mia40-substrate interactions across species

The conserved mechanism involves recognition of hydrophobic patches in substrate proteins that position specific cysteines for interaction with Mia40's redox-active CPC motif, though the exact cysteine residues targeted may differ between species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.