Recombinant Saccharomyces cerevisiae Mitochondrial membrane protein FMP33 (FMP33)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Fmp33

Fmp33 (UniProt ID: P46998) is encoded by the FMP33/YJL161W gene in S. cerevisiae. It is annotated as a putative mitochondrial membrane protein with unknown function, detected in high-throughput mitochondrial purification studies .

PropertyDetail
Gene synonymsYJL161W, J0552
Protein length180 amino acids
Molecular weight~20.2 kDa (theoretical)
Subcellular localizationMitochondrial outer membrane (MOM)
DomainsNo characterized domains; predicted α-helical transmembrane segments

The full-length recombinant protein includes residues 1–180, with an N-terminal His-tag for purification .

Mitochondrial Localization and Putative Roles

  • Fmp33 is classified as a MOM protein, but its topology (single-span vs. multispan) is unconfirmed .

  • Unlike multispan MOM proteins (e.g., Ugo1, Scm4), Fmp33’s biogenesis does not depend on cardiolipin synthase (Crd1), suggesting distinct integration mechanisms .

Functional Hypotheses

  • Membrane Dynamics: Fmp33 may contribute to mitochondrial membrane architecture, though no direct evidence links it to fusion/fission processes .

  • Protein Import: While not directly implicated in mitochondrial protein import pathways, Fmp33’s presence in MOM proteomes hints at auxiliary roles in translocase regulation or substrate recognition .

Interactions

  • BioGRID reports 33 physical/genetic interactions for Fmp33, including proteins involved in mitochondrial RNA processing (e.g., Mrpl32, Dbp2) .

Applications in Research

Recombinant Fmp33 is primarily used for:

  • Antibody Production: As an immunogen for generating anti-Fmp33 antibodies .

  • Structural Studies: Preliminary efforts to resolve its membrane topology or interaction partners .

  • Functional Screens: Included in genome-wide studies of mitochondrial protein biogenesis and genetic interaction networks .

Limitations and Future Directions

  • Functional Ambiguity: No knockout phenotypes or enzymatic activities have been reported, limiting mechanistic insights .

  • Expression Challenges: Native Fmp33 is undetectable in standard yeast expression screens, complicating validation of recombinant forms .

  • Therapeutic Relevance: Barth syndrome and other mitochondrial disorders involve cardiolipin defects , but Fmp33’s role in such pathways remains unexplored.

Key References

  1. Biogenesis of MOM Proteins: Highlights Fmp33’s mitochondrial localization and distinction from cardiolipin-dependent multispan proteins .

  2. Structural Studies of MOM Import: Discusses Fmp33 in the context of translocase machinery but lacks direct experimental data .

  3. Recombinant Production: Technical specifications from commercial suppliers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
FMP33; YJL161W; J0552; Mitochondrial membrane protein FMP33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FMP33
Target Protein Sequence
MLYTRLLRHNSQFTKFSGTSPNLGSKPLFSKGNLYTSLLVTTLYGTGLACLYLESNSLNK SKEQEDPHAIAEDDIVNIVHDAPNRIFKPALDTYQEKELDLQKSDLHKVLHSLTYSDVSQ FSIVWGFLIQLSSLIGNSTLGKKSILYKGSVVSVLGFPPLIYMALKLRMKQLEKAGVRFE
Uniprot No.

Target Background

Database Links

KEGG: sce:YJL161W

STRING: 4932.YJL161W

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is FMP33 and how is it localized in Saccharomyces cerevisiae?

FMP33 (Found in Mitochondrial Proteome 33) is a mitochondrial membrane protein in Saccharomyces cerevisiae. While specific information about FMP33 is limited in the literature, it belongs to a class of proteins identified through mitochondrial proteome studies. Like other mitochondrial membrane proteins in yeast, it may be involved in maintaining mitochondrial integrity, respiration, or protein transport functions.

To verify subcellular localization, researchers typically employ fluorescence microscopy using GFP-tagged versions of the protein. Similar to techniques used for other yeast proteins such as Reb1, fluorescence recovery after photobleaching (FRAP) can be employed to study protein dynamics, with typical recovery half-lives for mitochondrial membrane proteins ranging from seconds to minutes depending on their function and mobility .

How do I differentiate between FMP33 and other mitochondrial membrane proteins in experimental studies?

Differentiating FMP33 from other mitochondrial membrane proteins requires a multi-faceted approach:

  • Genetic tagging: Create epitope-tagged or fluorescent protein-tagged versions (GFP/RFP) of FMP33 to track its specific localization and dynamics.

  • Immunoblotting: Use specific antibodies against FMP33 if available, or against epitope tags engineered into the protein.

  • Mass spectrometry analysis: Employ proteomic approaches to identify FMP33 specifically among isolated mitochondrial membrane proteins.

  • Knockout verification: Compare wild-type and FMP33 deletion strains to confirm specificity of signals.

When analyzing FRAP data, it's important to compare recovery rates with other known mitochondrial proteins. For context, studies have shown that different classes of chromatin-associated proteins in yeast have characteristic recovery half-lives: histone H3 exchanges on hour time scales, RSC complex subunit Sth1 at approximately 7.8 seconds, and Nhp6A at less than 1 second .

What are the optimal conditions for recombinant expression of Saccharomyces cerevisiae FMP33?

Recombinant expression of mitochondrial membrane proteins like FMP33 presents unique challenges due to their hydrophobic nature and complex folding requirements. Based on approaches used for similar yeast mitochondrial proteins, the following strategies are recommended:

Expression systems comparison for yeast mitochondrial membrane proteins:

Expression SystemAdvantagesDisadvantagesTypical Yield for Mitochondrial Proteins
E. coliRapid growth, high yieldPotential misfolding of eukaryotic proteins0.5-2 mg/L culture
Yeast (S. cerevisiae)Native environment, proper foldingLower yield than bacterial systems0.2-1 mg/L culture
Insect cellsBetter for complex eukaryotic proteinsHigher cost, longer time1-5 mg/L culture

For FMP33 specifically, expression in S. cerevisiae itself may provide the most physiologically relevant protein, as it ensures proper targeting to mitochondria and appropriate post-translational modifications. When expressing in yeast, consider using strong inducible promoters like GAL1 or constitutive promoters like TEF1, depending on whether the protein's overexpression affects cell viability.

What purification strategies are most effective for obtaining functional FMP33 protein?

Purification of mitochondrial membrane proteins requires specialized approaches to maintain protein integrity and function:

  • Mitochondrial isolation: Begin with isolation of intact mitochondria using differential centrifugation from yeast cultures.

  • Solubilization optimization: Test a panel of detergents (DDM, LMNG, digitonin) at varying concentrations to efficiently extract FMP33 while maintaining its folded state.

  • Affinity chromatography: Utilize epitope tags (His, FLAG, Strep) for initial capture from solubilized mitochondrial extracts.

  • Size exclusion chromatography: Apply as a final polishing step to separate properly folded protein from aggregates.

The optimization of detergent conditions is particularly critical - too harsh conditions may denature the protein, while insufficient solubilization may result in poor yield. For each preparation, verify protein identity and integrity through mass spectrometry and functional assays specific to the predicted role of FMP33.

What experimental approaches can determine FMP33 interactions with other mitochondrial proteins?

Several complementary approaches can be employed to characterize protein-protein interactions involving FMP33:

  • Co-immunoprecipitation (Co-IP): Using tagged versions of FMP33 to pull down interaction partners from mitochondrial extracts, followed by mass spectrometry identification.

  • Proximity labeling: BioID or APEX2 tagging of FMP33 to identify proteins in close proximity within the mitochondrial environment.

  • Yeast two-hybrid screening: Modified versions for membrane proteins, such as split-ubiquitin yeast two-hybrid systems.

  • Genetic interaction screening: Synthetic genetic array (SGA) analysis comparing growth phenotypes of FMP33 deletion strains combined with other gene deletions.

Each method has specific strengths in identifying different types of interactions. For instance, transient interactions may be better captured by proximity labeling, while stable complexes are effectively detected by Co-IP approaches. Cross-validation using multiple methods strengthens confidence in identified interaction partners.

How can I assess the impact of FMP33 on mitochondrial function in Saccharomyces cerevisiae?

To evaluate the functional role of FMP33 in mitochondrial physiology, implement the following methodological approaches:

  • Respiratory capacity measurement: Compare oxygen consumption rates between wild-type and FMP33 deletion strains using respirometry.

  • Mitochondrial membrane potential assessment: Use potential-sensitive dyes (TMRM, JC-1) to measure changes in membrane potential when FMP33 is deleted or overexpressed.

  • Growth phenotype analysis: Evaluate growth on fermentable (glucose) versus non-fermentable (glycerol, ethanol) carbon sources, as defects in mitochondrial function typically manifest as poor growth on non-fermentable media.

  • ROS production measurement: Quantify reactive oxygen species using fluorescent probes to determine if FMP33 affects mitochondrial ROS homeostasis.

Data interpretation should account for the compartmentalized nature of yeast metabolism. The iND750 genome-scale metabolic model of S. cerevisiae, which incorporates 1149 reactions distributed across eight cellular compartments including the mitochondrion, can provide a systems-level framework for interpreting FMP33 function within the broader context of cellular metabolism .

What are the best strategies for creating FMP33 knockout strains in Saccharomyces cerevisiae?

Creating and validating FMP33 knockout strains requires careful consideration of several technical aspects:

  • Gene deletion strategies:

    • PCR-based gene replacement using selective markers (KanMX, HIS3, URA3)

    • CRISPR-Cas9 mediated deletion for marker-free modifications

    • Conditional systems (tetracycline-regulated or degron tags) if FMP33 deletion affects viability

  • Verification approaches:

    • PCR confirmation with primers flanking the targeted locus

    • Quantitative RT-PCR to confirm absence of transcript

    • Western blotting to verify protein absence

    • Whole genome sequencing to check for off-target effects in critical experiments

  • Controls and complementation:

    • Include isogenic wild-type controls in all experiments

    • Perform complementation with plasmid-expressed FMP33 to confirm phenotypes are specifically due to FMP33 loss

When analyzing growth phenotypes of gene deletion strains, it's important to note that genome-scale metabolic models like iND750 have achieved approximately 83% agreement between in silico predictions and experimental studies of growth phenotypes across different media conditions . Such models can help predict and interpret the metabolic consequences of FMP33 deletion.

What considerations are important when designing epitope-tagged versions of FMP33 for localization and interaction studies?

When creating epitope-tagged FMP33 constructs, several factors must be considered to ensure functionality:

  • Tag position optimization:

    • C-terminal tagging is often preferred for mitochondrial proteins to avoid disrupting N-terminal targeting sequences

    • If C-terminal tagging disrupts function, consider internal tagging at predicted loop regions

    • Test multiple constructs with tags at different positions

  • Tag selection considerations:

    • Small epitope tags (FLAG, HA, Myc) minimize functional interference

    • Fluorescent proteins (GFP, mCherry) enable live-cell imaging but may impact function

    • Split tags (split GFP, complementation systems) can reduce functional interference

  • Expression level control:

    • Native promoter expression maintains physiological levels

    • Inducible systems allow titration of expression for dose-response studies

    • Single-copy integration vs. plasmid-based expression affects consistency

  • Functional validation:

    • Compare growth rates and mitochondrial morphology between tagged strains and wild-type

    • Verify proper localization using mitochondrial markers

    • Confirm respiratory competence on non-fermentable carbon sources

For proteins with shorter half-lives or dynamic behaviors, FRAP analysis can provide valuable information. Recovery kinetics for mitochondrial membrane proteins typically fall between those of stable chromatin components (like histone H3) and highly mobile factors (like Nhp6A) , with specific rates depending on their functional roles and interaction partners.

How can systems biology approaches be applied to understand FMP33's role in the mitochondrial interactome?

Integrating FMP33 research into systems biology frameworks requires sophisticated experimental and computational approaches:

  • Multi-omics integration:

    • Combine proteomics data on FMP33 interactions with transcriptomics of deletion strains

    • Correlate metabolomic changes with FMP33 expression levels

    • Map physical and genetic interactions onto pathway models

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on FMP33

    • Identify network modules affected by FMP33 perturbation

    • Apply graph theory metrics to quantify FMP33's centrality in mitochondrial networks

  • Constraint-based modeling:

    • Incorporate FMP33-specific constraints into genome-scale metabolic models

    • Perform flux balance analysis to predict metabolic consequences of FMP33 deletion

    • Use enzyme-constrained models to simulate the impact of altered FMP33 levels

The fully compartmentalized genome-scale model iND750, which accounts for 750 genes and 1149 reactions across eight cellular compartments including the mitochondrion, provides a valuable framework for integrating FMP33 function into a systems-level understanding of yeast metabolism . This model can be used to predict the impact of FMP33 perturbations on metabolic fluxes and growth phenotypes across different environmental conditions.

What methodological challenges exist in studying the dynamics of FMP33 in living cells, and how can they be addressed?

Investigating FMP33 dynamics in living cells presents several methodological challenges with corresponding solutions:

  • Spatial resolution limitations:

    • Challenge: Standard fluorescence microscopy may not resolve suborganellar localization

    • Solutions: Super-resolution microscopy (STED, PALM, STORM), correlative light and electron microscopy (CLEM)

  • Temporal dynamics measurement:

    • Challenge: Capturing rapid protein movements or conformational changes

    • Solutions: FRAP, fluorescence correlation spectroscopy (FCS), single-molecule tracking

  • Protein-protein interaction dynamics:

    • Challenge: Detecting transient or weak interactions in the native environment

    • Solutions: FRET, split fluorescent protein complementation, optogenetic tools

  • Distinguishing pools of protein:

    • Challenge: Differentiating newly synthesized from existing proteins

    • Solutions: Pulse-chase labeling with photoconvertible fluorescent proteins, SNAP tags

For FRAP experiments specifically, the measurement settings should be optimized based on expected recovery kinetics. For comparison, studies have demonstrated that chromatin-associated proteins in yeast exhibit recovery half-lives ranging from under 1 second (Nhp6A) to 7.8 seconds (Sth1) to over a minute (histone H3) . Mitochondrial membrane proteins typically fall within this spectrum depending on their mobility and interaction partners.

What strategies help overcome protein aggregation problems when working with recombinant FMP33?

Membrane protein aggregation is a common challenge that can be addressed through methodical optimization:

  • Expression condition screening:

    • Test multiple temperatures (16°C, 20°C, 30°C) with corresponding longer induction times at lower temperatures

    • Vary induction strength using titratable promoters

    • Evaluate co-expression with chaperones specific to mitochondrial protein folding

  • Solubilization optimization:

    • Systematic screening of detergent types, concentrations, and combinations

    • Consider native-like environments: nanodiscs, liposomes, amphipols

    • Test detergent:protein ratios to identify optimal solubilization conditions

  • Buffer optimization:

    • Screen pH ranges, salt concentrations, and stabilizing additives

    • Include glycerol or specific lipids that may stabilize mitochondrial membrane proteins

    • Test the addition of specific substrates or cofactors that may stabilize the folded state

  • Advanced analytical techniques:

    • Use size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess protein homogeneity

    • Apply circular dichroism (CD) spectroscopy to verify secondary structure integrity

    • Employ thermal shift assays to identify stabilizing conditions

Each protein may require a unique combination of conditions for optimal results, necessitating systematic testing and optimization specific to FMP33's properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.