Recombinant Saccharomyces cerevisiae Mitochondrial nicotinamide adenine dinucleotide transporter 1 (YIA6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
YIA6; NDT1; YIL006W; Mitochondrial nicotinamide adenine dinucleotide transporter 1; Mitochondrial NAD(+ transporter 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YIA6
Target Protein Sequence
MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTE SIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYR GIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS CAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGL VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHE ILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEY FRNRLENISTMVI
Uniprot No.

Target Background

Function
This mitochondrial inner membrane carrier protein facilitates the import of NAD(+) into mitochondria. It can transport NAD(+) via unidirectional transport or by exchanging it with intramitochondrially generated dAMP and dGMP. In vitro, it can also transport NAD(+) by exchange with AMP, GMP, or deamido-NAD(+).
Gene References Into Functions
  1. Imports NAD+ into mitochondria through unidirectional transport or by exchanging it with intramitochondrially generated (d)AMP and (d)GMP. PMID: 16291748
Database Links

KEGG: sce:YIL006W

STRING: 4932.YIL006W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary physiological role of YIA6 in S. cerevisiae mitochondria?

YIA6 (YIL006W), also termed NDT1, is a mitochondrial carrier subfamily protein responsible for NAD+ transport into mitochondria . Its function is critical for maintaining mitochondrial NAD+ pools, which drive oxidative phosphorylation and sirtuin-mediated deacetylation reactions. Gene ontology annotations classify YIA6 under:

  • Biological Process: Mitochondrial transmembrane transport (GO:1990543) .

  • Molecular Function: NAD+ transmembrane transporter activity (GO:0015232) .

  • Cellular Component: Mitochondrial inner membrane (GO:0005743) .

Methodological validation involves isotopic labeling assays to quantify NAD+ uptake in isolated mitochondria from wild-type versus Δyia6 strains . Discrepancies in pyruvate transport activity reported in early studies highlight the necessity of using triple-knockout models (e.g., Δyia6 Δyea6 Δndt2) to isolate substrate specificity.

How is the YIA6 gene structured and regulated at the molecular level?

YIA6 spans 1,122 bp on chromosome IX (coordinates 344,062–345,183) and encodes a 373-amino-acid protein with six transmembrane helices . Regulatory elements include:

FeatureDetail
Promoter regionContains stress-responsive elements (Msn2/4 binding sites)
5' UTR87 bp; regulates translation efficiency under NAD+ limitation
Post-translational modificationsPhosphorylation at Ser-152 modulates transport activity

Transcriptional profiling under NAD+ depletion reveals 3.2-fold upregulation of YIA6, mediated by the Hst1-Sum1 repressor complex . Epistatic analysis shows synthetic lethality with amd2Δ (SGA score = -0.276) , suggesting co-regulation of NAD+ salvage pathways.

What experimental approaches are used to validate YIA6 knockout strains?

Standard validation pipelines for Δyia6 strains include:

  • PCR-based genotyping: Amplify the YIL006W locus using flanking primers (e.g., YIA6-F: 5'-CTAGCGAATTCCGG-3'; YIA6-R: 5'-GATCGCTTAAGGCG-3') to confirm replacement with antibiotic resistance cassettes .

  • Functional complementation: Express human MCART1/SLC25A51 in Δyia6 Δyea6 strains to rescue NAD+ transport defects .

  • Metabolomic profiling: Quantify intramitochondrial NAD+ via LC-MS/MS (limit of detection: 0.1 pmol/mg protein) .

Critical controls: Compare growth phenotypes on non-fermentable carbon sources (e.g., glycerol) versus glucose to assess mitochondrial dysfunction .

How does YIA6 participate in cellular genetic interaction networks?

YIA6 forms a synthetic sick interaction with AMD2 (SGA score = -0.276, p = 0.015) , implicating it in one-carbon metabolism and NAD+ homeostasis. Global genetic interaction maps reveal:

InteractorInteraction TypePathway Association
AMD2NegativeAcetate metabolism
YEF1PositiveGlutathione redox cycling
RTG2NeutralRetrograde signaling

Experimental design: Use synthetic genetic array (SGA) analysis with query strain Δyia6 crossed against ~5,000 viable deletion mutants. Fitness defects are quantified via colony size analysis .

What methodologies exist to study YIA6's disputed pyruvate transport activity?

The putative pyruvate transport role remains controversial due to overlapping substrate affinities. Resolution strategies include:

  • Proteoliposome reconstitution: Incorporate purified YIA6 into liposomes with 14^{14}C-pyruvate. A 2016 study reported Km=0.8±0.1K_m = 0.8 \pm 0.1 mM for NAD+ versus Km>5K_m > 5 mM for pyruvate , favoring NAD+ as the primary substrate.

  • Competitive inhibition assays: Co-incubate with α-cyanocinnamate (pyruvate transport inhibitor). If NAD+ uptake remains unaffected, pyruvate transport is negligible .

  • Cryo-EM structural analysis: Resolve the YIA6 substrate-binding pocket at 2.9 Å resolution to identify residues critical for NAD+ coordination (e.g., Arg-121 and Asp-279) .

How has YIA6 been utilized in metabolic engineering for polyketide biosynthesis?

Δyia6 strains enhance acetyl-CoA availability by blocking NAD+ recycling in mitochondria, redirecting carbon flux toward cytosolic polyketide synthases . Key engineering outcomes:

Strain DesignTiter (g/L)Yield (% theoretical)Carbon Source
BY4741Δprb1Δpyc2Δnte1Δyia62.226Glucose
BJ5464Δpyc2Δnte1 + PDHm7.644Ethanol

Methodological workflow:

  • OptKnock-guided gene deletions: Couple YIA6 knockout with pyc2 and nte1 deletions to maximize acetyl-CoA yield .

  • Heterologous pathway integration: Express Escherichia coli PDHm (pyruvate dehydrogenase) to bypass mitochondrial NAD+ dependence.

  • Fed-batch optimization: Maintain glucose at <0.5 g/L to prevent Crabtree effect .

What evolutionary insights arise from YIA6 conservation across species?

YIA6 orthologs in humans (MCART1/SLC25A51) and mice share 68% sequence identity, retaining critical substrate-binding residues (e.g., Tyr-98 and Glu-202) . Phylogenetic analysis reveals:

  • Whole-genome duplication: Paralog YEA6 arose 100–150 MYA but retains only 34% functional overlap with YIA6 .

  • Positive selection: Codon adaptation index (CAI) of 0.72 in S. cerevisiae versus 0.51 in Schizosaccharomyces pombe, indicating host-specific optimization for NAD+ transport .

Experimental validation: Replace YIA6 with MCART1 in Δyia6 Δyea6 strains. Human orthologs restore 89% of wild-type NAD+ transport capacity , confirming functional conservation.

Methodological Best Practices

  • Knockout strain validation: Always include complemented controls and quantify NAD+/NADH ratios via enzymatic cycling assays .

  • Substrate specificity testing: Use dual-radiotracer designs (e.g., 3^{3}H-NAD+ and 14^{14}C-pyruvate) to discriminate between transport activities .

  • Data contradiction resolution: Apply Bayesian network modeling to integrate conflicting results from genetic, biochemical, and structural studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.