Recombinant Saccharomyces cerevisiae Mitochondrial organizing structure protein 2 (MOS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MIC26; MCS29; MIO27; MOS2; YGR235C; G8575; MICOS subunit MIC26; Mitochondrial contact site complex 29 kDa subunit; Mitochondrial inner membrane organization component of 27 kDa; Mitochondrial organizing structure protein 2; MitOS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MIC26
Target Protein Sequence
MTKDFYRQLDPVEEKIVPPENAIVISSEAKEATVNEKEAKQGVLSQRVMKYIGENELVDG ISVRDPDYLKRFFNERRKQFSAKWDKVTNKIDDIAGRYYAREESFTSTIASLHTDPNERL IPGLLSILVASMTGSVLARRRTWLLRATMPIILGSCCFAYAMPTTFRNTMGLIHNLEMNT FPHFTERQDRVWKETKRLSTASVQYYYDAKKWLNKDVEKTGNAIKNWTGVNVK
Uniprot No.

Target Background

Function

Recombinant Saccharomyces cerevisiae Mitochondrial Organizing Structure protein 2 (MOS2): A component of the MICOS complex, a large protein complex within the mitochondrial inner membrane. MICOS plays crucial roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating the formation of contact sites with the outer membrane.

Database Links

KEGG: sce:YGR235C

STRING: 4932.YGR235C

Protein Families
Apolipoprotein O/MICOS complex subunit Mic27 family, Yeast Mic26 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MOS2 in Saccharomyces cerevisiae and what are its alternative names?

MOS2 (Mitochondrial organizing structure protein 2) is one of six subunits comprising the Mitochondrial Inner Membrane Organizing System (MINOS) complex in yeast. The protein is encoded by the YGR235C gene and goes by several alternative names in scientific literature, including MIC26, MCS29 (Mitochondrial contact site complex 29 kDa subunit), MIO27 (Mitochondrial inner membrane organization component of 27 kDa), and MitOS2 . This 233-amino acid protein is primarily localized to the inner mitochondrial membrane with exposure to the intermembrane space, where it contributes to maintaining proper cristae morphology .

How does one express and purify recombinant MOS2 protein?

For researchers needing recombinant MOS2 for experimental studies, the protein can be successfully expressed in E. coli expression systems using the following methodology:

Expression system: Full-length Saccharomyces cerevisiae MOS2 (1-233aa) fused to an N-terminal His tag in E. coli .

Purification protocol:

  • Express His-tagged MOS2 in suitable E. coli strain

  • Lyse cells and purify using affinity chromatography (His-tag based)

  • Verify purity by SDS-PAGE (expect >90% purity)

  • Prepare as lyophilized powder in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Storage recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot for multiple uses to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

This methodological approach ensures the production of high-quality recombinant protein suitable for structural studies, antibody generation, or functional assays.

What phenotype is associated with MOS2 deletion in yeast?

MOS2 deletion (mos2Δ) results in a relatively mild phenotype compared to the deletion of other MINOS components, suggesting its more peripheral or potentially redundant role within the complex. Specifically:

  • Mitochondrial morphology defects in mos2Δ cells are less severe than those observed in other MINOS component deletions (e.g., aim37Δ and aim13Δ)

  • The cristae phenotype in mos2Δ is significantly less severe than in other MINOS deletion strains

  • This milder phenotype correlates with biochemical data indicating that steady-state levels of MOS2 are independent of other MitOS subunits

To methodologically analyze these phenotypes, researchers typically employ:

How does MOS2 function in relation to other MINOS complex components?

Within the MINOS complex, MOS2 appears to have a distinct role compared to core components:

  • MOS2 is part of the six-subunit MINOS complex along with mitofilin/Fcj1 (core protein), Mio10/Mcs10/Mos1 (core protein), Aim5/Mcs12, Aim13/Mcs19, and Aim37/Mcs27

  • Unlike the core components mitofilin/Fcj1 and Mio10, which are essential for maintaining cristae membrane attachment to the inner boundary membrane, MOS2 likely serves a supportive role

  • The steady-state levels of MOS2 are independent of other MitOS subunits, suggesting it may have regulatory functions or additional roles outside the complex

  • MOS2, along with Aim5, may possess a more peripheral and/or redundant role within MitOS based on the milder phenotypes observed in deletion strains

What is the role of MOS2 in mitochondrial protein import?

  • While mitofilin is required for the biogenesis of β-barrel proteins of the outer membrane, mitochondria lacking MOS2 (and other non-core MINOS subunits) import β-barrel proteins similarly to wild-type mitochondria

  • Mitofilin binds to the SAM complex via the conserved polypeptide transport-associated domain of Sam50, but the specific interaction sites for MOS2 remain undetermined

To methodologically investigate MOS2's role in protein import, researchers should:

  • Perform in vitro import assays comparing wild-type and mos2Δ mitochondria using radiolabeled precursor proteins targeted to different submitochondrial compartments

  • Analyze the kinetics of protein import and determine whether specific import pathways are affected

  • Conduct co-immunoprecipitation experiments to identify physical interactions between MOS2 and components of the import machinery

  • Create double mutants combining mos2Δ with mutations in import machinery components to identify potential genetic interactions

How does MOS2 contribute to maintaining mitochondrial cristae structure?

The MINOS complex plays a crucial role in maintaining cristae junctions, which connect cristae membranes with the inner boundary membrane . Regarding MOS2's specific contribution:

  • While cristae junctions can still form in the absence of any MINOS component (including MOS2), their density is reduced compared to wild-type mitochondria

  • MOS2 deletion results in a milder cristae phenotype compared to deletion of core components like mitofilin/Fcj1

  • Electron tomography of MINOS mutant mitochondria shows that the shape or dimensions of cristae junctions that do form are not significantly altered, suggesting MINOS (including MOS2) may function primarily through a different mechanism to regulate inner membrane structure and/or cristae junction maintenance

  • The MINOS complex appears to function in opposition to the ATP synthase, as fcj1 rho0 cells (lacking assembled respiratory chain complexes) show suppression of the abnormal cristae phenotype observed in fcj1 rho+ cells

For rigorous investigation of MOS2's role in cristae structure, researchers should employ electron microscopy (both conventional TEM and electron tomography) to quantitatively analyze cristae number, length, width, and junction diameter in various genetic backgrounds.

What is the evolutionary conservation of MOS2 and how does it compare to other MINOS components?

Understanding the evolutionary conservation of MOS2 provides insights into its fundamental importance for mitochondrial function:

  • While one MINOS component (Aim5) appears to be fungal-specific, MOS2 and other MINOS components are conserved or possess predicted conserved features across species

  • This conservation suggests that the structure and function of the MINOS complex, including MOS2, is likely evolutionarily preserved

Methodological approaches to study this conservation include:

  • Sequence alignment analysis of MOS2 homologs from various species using bioinformatics tools

  • Phylogenetic tree construction to visualize evolutionary relationships

  • Functional complementation studies by expressing homologs from different species in mos2Δ yeast

  • Domain conservation analysis to identify critical structural and functional elements

This evolutionary perspective helps prioritize which aspects of MOS2 function are most likely to be functionally significant.

How can one distinguish between MOS2 (yeast mitochondrial protein) and MoS2 (molybdenum disulfide) in research contexts?

An important clarification for researchers encountering both terms in literature searches:

  • MOS2 (uppercase "O") refers to the Mitochondrial Organizing Structure protein 2 in Saccharomyces cerevisiae, a component of the MINOS complex involved in mitochondrial inner membrane organization

  • MoS2 (lowercase "o") refers to molybdenum disulfide, a transition-metal dichalcogenide with a layered structure used in various applications including electronics and battery materials

Interestingly, research does exist investigating the effects of MoS2 (molybdenum disulfide) on yeast cells. One study found that:

  • High concentrations (≥1 mg/L) of bulk MoS2 can destroy yeast cell membranes and induce ROS accumulation

  • Exposure affects metabolic pathways including amino acid and citrate cycle metabolism

  • Low concentrations (0.1 mg/L) increased intracellular concentrations of certain metabolites

Researchers should be careful to specify which entity they are studying and ensure proper capitalization in manuscripts to avoid confusion.

What techniques are most effective for studying MOS2 localization and interactions within mitochondria?

For comprehensive analysis of MOS2 localization and interactions, researchers should consider a multi-modal approach:

For localization studies:

  • Fluorescent protein tagging of MOS2 (C-terminal GFP fusion) for live-cell imaging

  • Immunogold labeling coupled with electron microscopy for high-resolution localization

  • Biochemical fractionation of mitochondria into membrane and soluble fractions

  • Protease protection assays to determine membrane topology

For interaction studies:

  • Co-immunoprecipitation with known MINOS components and candidate interacting proteins

  • Proximity labeling using BioID or APEX2 fused to MOS2

  • Crosslinking mass spectrometry to capture direct binding partners

  • Blue native PAGE to analyze intact complexes containing MOS2

  • Yeast two-hybrid or split-protein complementation assays for binary interactions

For optimal results, validate key findings using multiple complementary approaches and include appropriate controls (including tests of tagged protein functionality by complementation of mos2Δ phenotypes).

How can one analyze the impact of MOS2 mutations on mitochondrial function and morphology?

A systematic approach to analyzing MOS2 mutations includes:

Generation of mutations:

  • Site-directed mutagenesis targeting conserved residues

  • Domain deletion/swapping to identify functional regions

  • Random mutagenesis followed by phenotypic screening

  • Introduction of disease-associated mutations from homologs

Functional assessment methodology:

  • Mitochondrial morphology analysis:

    • Fluorescence microscopy with mitochondrial markers

    • Transmission electron microscopy for cristae ultrastructure

    • Quantitative image analysis for morphometric parameters

  • Bioenergetic assessment:

    • Oxygen consumption measurements

    • Membrane potential determination

    • ATP production assays

    • ROS generation quantification

  • Protein interaction studies:

    • Co-immunoprecipitation to test interaction with MINOS components

    • Blue native PAGE to analyze complex integrity

    • FRET/FLIM to measure protein proximity in vivo

  • Genetic interaction analysis:

    • Synthetic genetic array analysis with mutant strains

    • Suppressor screens to identify functional relationships

This comprehensive approach allows for detailed structure-function analysis of MOS2 and identification of critical domains for specific aspects of its function.

What are the technical considerations for studying MOS2 in relation to the biogenesis of mitochondrial membrane proteins?

To study MOS2's potential role in mitochondrial membrane protein biogenesis:

Experimental approaches:

  • In vitro import assays:

    • Isolate mitochondria from wild-type and mos2Δ strains

    • Prepare radiolabeled precursor proteins (representing different import pathways)

    • Incubate precursors with isolated mitochondria

    • Analyze import by SDS-PAGE and autoradiography

    • Compare kinetics and efficiency of import

  • Assembly analysis:

    • Use blue native PAGE to separate assembled complexes

    • Track formation of assembly intermediates

    • Perform pulse-chase experiments to follow protein maturation

  • In vivo analysis:

    • Monitor steady-state levels of various mitochondrial proteins

    • Analyze protein half-lives using cycloheximide chase

    • Visualize import using fluorescent reporter proteins

Technical considerations:

  • Control for indirect effects of altered cristae morphology

  • Include multiple substrate proteins targeting different submitochondrial compartments

  • Test under various conditions (temperature, ATP availability)

  • Use quantitative approaches rather than qualitative assessments

  • Compare with defects in known import pathway components as controls

This methodological approach can help distinguish direct effects of MOS2 on protein import from indirect consequences of altered mitochondrial structure.

How does MOS2 relate to mitochondrial contact sites and other membrane organizing systems?

The MINOS complex, including MOS2, plays a key role at mitochondrial contact sites and interfaces with other membrane systems:

  • MINOS has been identified as a mitochondrial contact site complex that helps maintain connections between the cristae membranes and the inner boundary membrane

  • Search result indicates that mitochondrial shapes and dynamics are finely tuned by fusion and fission proteins, and these processes likely involve reorganization of MINOS components including MOS2

  • The MINOS complex interacts with both TOM and SAM complexes of the outer membrane, forming a functional network that spans both mitochondrial membranes

Future research directions should include:

  • Investigation of MOS2's role in mitochondria-ER contact sites

  • Analysis of MOS2 distribution and dynamics during mitochondrial fusion/fission events

  • Exploration of potential interactions with components of the ERMES (ER-mitochondria encounter structure) complex

  • Examining how MOS2 contributes to lipid transfer between membranes

These studies would provide a more comprehensive understanding of MOS2's role in mitochondrial membrane organization beyond the MINOS complex.

What potential applications exist for using recombinant MOS2 in biotechnology?

While currently primarily a research tool, recombinant MOS2 offers potential biotechnological applications:

  • As a research reagent:

    • Generation of antibodies for studying yeast mitochondrial organization

    • Development of mitochondrial targeting systems based on MOS2 domains

    • Creation of biosensors for monitoring mitochondrial membrane organization

  • For therapeutic development:

    • Study of homologous human proteins for targeting mitochondrial diseases

    • Platform for drug screening targeting mitochondrial membrane organization

    • Model system for testing compounds affecting cristae remodeling

  • In synthetic biology:

    • Engineering mitochondrial architecture for optimized metabolic outputs

    • Development of minimal mitochondrial systems with defined components

    • Creation of reporter systems for monitoring mitochondrial stress

These applications would benefit from the continuing advancement of structural and functional studies of MOS2 and the MINOS complex as a whole.

How does MOS2 function relate to yeast mitochondrial DNA stability and inheritance?

While direct evidence linking MOS2 to mtDNA stability is limited in the search results, there are potential connections worth investigating:

  • Search result discusses spontaneous loss of mitochondrial DNA (mtDNA) leading to the petite phenotype in yeast, which is influenced by genetic variation in nuclear DNA, mtDNA, and mitonuclear interactions

  • Since MOS2 is part of the MINOS complex that organizes mitochondrial inner membrane structure, it may indirectly affect nucleoid organization and distribution

  • The relationship between mitochondrial cristae structure (which MOS2 helps maintain) and mtDNA stability is an important area for future research

Methodological approaches to investigate this connection include:

  • Measuring rates of mtDNA loss in mos2Δ strains compared to wild-type

  • Analyzing mtDNA distribution using fluorescence microscopy in different genetic backgrounds

  • Examining genetic interactions between MOS2 and known mtDNA maintenance factors

  • Testing whether MOS2 overexpression can suppress mtDNA instability in other mutant backgrounds

This research direction could reveal new functions for MOS2 beyond its structural role in the MINOS complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.