Recombinant Saccharomyces cerevisiae Mitochondrial ornithine transporter 1 (ORT1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae mitochondrial ornithine transporter 1 (ORT1), encoded by the ARG11 (YOR130C) gene, is a mitochondrial membrane protein critical for ornithine transport between the matrix and cytosol. This transporter facilitates arginine biosynthesis by shuttling ornithine out of mitochondria, where it is converted to arginine in the cytosol . Recombinant ORT1 is produced via heterologous expression in Escherichia coli, enabling structural, functional, and therapeutic studies.

Gene Structure and Functional Domains

ORT1 is a 292-amino-acid protein (UniProt ID: Q12375) with six transmembrane domains characteristic of mitochondrial carrier proteins . Key structural features include:

  • N-terminal domain: Contains a putative mitochondrial targeting signal (first 20 residues) .

  • Core domains: Hydrophobic regions forming the transport channel .

  • C-terminal tail: May mediate protein-protein interactions .

Gene InformationDetails
Gene NameORT1, ARG11
Chromosomal LocationYOR130C
Protein Length292 amino acids
UniProt AccessionQ12375
SynonymsMitochondrial ornithine transporter 1

ORT1’s transport activity has been validated in liposomal reconstitution and yeast complementation assays:

Key Findings

  1. Substrate Specificity:

    • Transport ornithine with antiport activity (H⁺/ornithine exchange) .

    • Competed by citrulline, arginine, and lysine .

  2. Mutational Analysis:

    • Pathogenic Mutations (e.g., ΔF188 in human SLC25A15 homologs):

      • Impaired membrane integration and transport activity .

      • Failed to rescue ORT1Δ yeast growth in arginine-limited media .

    • Engineered Mutations (e.g., p.F188Y):

      • Retained partial activity but lacked complementation capacity .

MutationEffect on TransportYeast Complementation
ΔF188 (human)Reduced membrane integration; loss of stereospecificity No rescue
p.F188YPartial activity retainedNo rescue
p.R275QImpaired transportNo rescue

Metabolic Engineering

  • Arginine Biosynthesis: ORT1 deletion strains require arginine supplementation, enabling pathway optimization for L-ornithine production in yeast .

  • Pathway Rewiring: Modulating ARG3 expression (ornithine carbamoyltransferase) enhances ornithine accumulation, achieving titers up to 1,041 mg/L .

Disease Modeling

  • Hyperornithinemia-Hyperammonemia-Homocitrullinuria (HHH) Syndrome: ORT1 homologs (e.g., human SLC25A15) are studied using yeast models to assess mutation pathogenicity .

Research Challenges and Future Directions

  1. Structural Insights:

    • High-resolution crystallography of ORT1 remains unresolved, limiting mechanistic understanding .

  2. Therapeutic Potential:

    • Recombinant ORT1 could inform treatments for urea cycle disorders by elucidating transporter dysfunction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORT1; ARG11; YOR130C; O3299; YOR3299C; Mitochondrial ornithine transporter 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ORT1
Target Protein Sequence
MEDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTY QNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVSPLGQILISGGVAGSC ASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRES FGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSV MQTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSAL
Uniprot No.

Target Background

Function
Essential for arginine biosynthesis. ORT1 transports ornithine, synthesized from glutamate within the mitochondrial matrix, to the cytosol for subsequent conversion to arginine.
Database Links

KEGG: sce:YOR130C

STRING: 4932.YOR130C

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Mitochondrial Ornithine Transporter 1?

Saccharomyces cerevisiae Mitochondrial Ornithine Transporter 1 (ORT1) is a nuclear-encoded mitochondrial carrier protein that facilitates the transport of ornithine across the inner mitochondrial membrane. It belongs to the mitochondrial carrier family (MCF) of proteins characterized by a tripartite structure with three tandemly repeated approximately 100-amino acid domains. ORT1 catalyzes the exchange of cytosolic ornithine for mitochondrial citrulline, playing a crucial role in the arginine biosynthesis pathway in yeast. This carrier protein consists of 292 amino acids and functions as a key component in nitrogen metabolism and the urea cycle in eukaryotic cells .

The protein, also known by synonyms ARG11, YOR130C, O3299, and YOR3299C, has gained significant importance as a model system for studying the functional implications of mutations in its human ortholog, SLC25A15 (human mitochondrial ornithine carrier 1), which is associated with HHH syndrome .

What is the functional role of ORT1 in yeast metabolism?

ORT1 plays a critical role in nitrogen metabolism and arginine biosynthesis in S. cerevisiae. Its primary function is to catalyze the exchange of cytosolic ornithine for mitochondrial citrulline across the inner mitochondrial membrane. This transport activity is essential for the proper functioning of the arginine biosynthesis pathway, which involves enzymes located in both the mitochondria and the cytosol.

The functional significance of ORT1 is evidenced by studies showing that ORT1 null mutants (ORT1Δ) exhibit arginine auxotrophy, meaning they cannot grow on media lacking arginine. This phenotype can be rescued by reintroducing functional ORT1, demonstrating the protein's indispensable role in arginine metabolism .

Additionally, ORT1 contributes to nitrogen recycling and ammonia detoxification processes in yeast, paralleling the role of its human ortholog in the urea cycle. This functional conservation makes ORT1 an excellent model for investigating the molecular mechanisms underlying human disorders associated with mitochondrial ornithine transport defects .

How can recombinant ORT1 protein be expressed and purified?

Recombinant ORT1 protein can be expressed and purified using several established protocols tailored for membrane proteins. A common and effective approach involves:

  • Expression System Selection: E. coli BL21(DE3) or similar strains are typically used for heterologous expression of ORT1. The gene sequence encoding full-length ORT1 (1-292 amino acids) is cloned into an expression vector containing an N-terminal His-tag for purification purposes .

  • Vector Construction: The ORT1 gene is inserted into a pET-series vector (e.g., pET28a) under the control of a strong T7 promoter. The construct should include a His-tag sequence (typically 6× histidine) at the N-terminus for affinity purification.

  • Expression Conditions: Transformed E. coli cells are grown in LB medium containing appropriate antibiotics to mid-log phase (OD600 ~0.6-0.8), followed by induction with IPTG (typically 0.5-1.0 mM) for 4-6 hours at 25-30°C. Lower induction temperatures can help reduce inclusion body formation.

  • Cell Lysis and Membrane Fraction Isolation: Cells are harvested by centrifugation and disrupted using a combination of enzymatic treatment (lysozyme) and physical methods (sonication or high-pressure homogenization). The membrane fraction is isolated through differential centrifugation.

  • Solubilization and Purification: Membrane proteins are solubilized using detergents (such as n-dodecyl-β-D-maltoside or Triton X-100). The His-tagged ORT1 is purified using Ni-NTA affinity chromatography, followed by size exclusion chromatography for higher purity.

  • Final Preparation: The purified protein is concentrated and either used directly for functional studies or lyophilized for long-term storage .

What transport assays are effective for studying ORT1 function?

Several transport assays have been developed to characterize the function of ORT1, with liposome-based transport assays being the gold standard. These methodologies include:

  • Reconstituted Liposome Transport Assay: This approach involves:

    • Reconstitution of purified ORT1 into liposomes composed of a defined lipid mixture (typically phosphatidylcholine and phosphatidylethanolamine at a 4:1 ratio)

    • Preloading liposomes with internal substrate (typically citrulline)

    • Initiating transport by adding external substrate (ornithine) often radiolabeled for detection

    • Measuring substrate exchange over time using filtration and scintillation counting

  • Substrate Specificity Determination:

    • Competitive inhibition assays using various potential substrates

    • Measurement of transport rates with different substrate concentrations to determine Km and Vmax values

The reconstituted liposome transport assay has been successfully used to evaluate the functional impact of mutations in ORT1. For instance, studies have employed this method to assess the transport capabilities of various mutant proteins (such as p.G27R, p.M37R, p.F188L, and p.R275Q) compared to wild-type ORT1 .

Table 1: Typical Transport Assay Conditions for ORT1

ParameterCondition
Liposome compositionPhosphatidylcholine:Phosphatidylethanolamine (4:1)
Protein:lipid ratio1:100 (w/w)
Internal substrate[14C]Citrulline (1 mM)
External substrateOrnithine (1-10 mM range)
Buffer20 mM HEPES, 50 mM NaCl, pH 7.2
Temperature25°C
Time points0, 1, 2, 5, 10, 15, 30 min
ControlsProtein-free liposomes, valinomycin-treated liposomes

How can ORT1 knockout strains be generated and validated?

Generation and validation of ORT1 knockout strains involve several key steps:

  • Knockout Generation:

    • Homologous recombination approach: Replace the ORT1 open reading frame with a selection marker (commonly URA3, LEU2, or KanMX4) flanked by sequences homologous to regions upstream and downstream of the ORT1 gene

    • CRISPR-Cas9 method: Design guide RNAs targeting ORT1 and introduce them along with Cas9 and a repair template containing a selection marker

  • Selection of Transformants:

    • Plate transformed cells on selective media based on the marker used

    • Isolate and purify individual colonies for further verification

  • Validation Approaches:

    • PCR verification: Design primers flanking the expected insertion site and within the selection marker

    • Southern blot analysis: Confirm the absence of the ORT1 gene and presence of the selection marker at the correct locus

    • Growth phenotype: ORT1Δ strains should exhibit arginine auxotrophy (inability to grow on minimal media lacking arginine)

    • Complementation testing: Reintroduction of functional ORT1 should rescue the arginine auxotrophy phenotype

  • Functional Validation:

    • Growth curve analysis in the presence and absence of arginine

    • Measurement of intracellular ornithine and citrulline levels

    • Assessment of mitochondrial function and integrity

ORT1 knockout strains have been extensively used in complementation studies to evaluate the functional significance of ORT1 mutations and their human orthologs. These strains serve as an excellent platform for studying the structure-function relationships of ornithine transporters and for validating the pathogenicity of mutations identified in patients with HHH syndrome .

How is ORT1 used as a model for human ornithine transporters?

ORT1 serves as an invaluable model for understanding human mitochondrial ornithine transporters, particularly SLC25A15 (ORNT1), due to their high degree of functional and structural conservation. This relationship enables several important research applications:

  • Functional Complementation Studies: ORT1-deficient yeast strains (ORT1Δ) can be used to express and assess the functionality of human SLC25A15 and its variants. This approach has been instrumental in determining the pathogenicity of mutations identified in patients with HHH syndrome. When the human wildtype SLC25A15 is expressed in ORT1Δ yeast, it can rescue the arginine auxotrophy phenotype, demonstrating functional conservation across species .

  • Structure-Function Analysis: The similarity between ORT1 and human ornithine transporters allows researchers to use the yeast protein as a template for developing structural models of human carriers. Key residues and domains identified in ORT1 can be mapped onto human orthologs to predict functional sites and potential mutation hotspots.

  • Drug Development Platform: ORT1-expressing yeast systems can serve as a platform for screening compounds that might enhance the function of defective human ornithine transporters, potentially leading to therapeutic interventions for related disorders.

  • Evolutionary Studies: Comparative analysis of ORT1 and its orthologs across species provides insights into the evolution of mitochondrial carrier proteins and their specialized functions in different organisms.

The utility of ORT1 as a model is evidenced by studies showing that mutations in human SLC25A15 associated with HHH syndrome often have corresponding functional defects when analogous mutations are introduced into ORT1, confirming the high degree of functional conservation between these proteins .

What mutations have been studied in ORT1 and what were their effects?

Numerous mutations in ORT1 have been systematically studied to understand their impact on protein function and to establish correlations with human disease-causing mutations. These studies have provided critical insights into the structure-function relationships of mitochondrial ornithine transporters.

Table 2: Effects of Key ORT1 Mutations on Protein Function

MutationTransport ActivityComplementation of ORT1ΔCorrelation to Human Disease
p.G27RSeverely impairedNo complementationAnalogous to human mutation causing HHH syndrome
p.M37RSeverely impairedSlight complementation after 5 daysPathogenic in humans
p.N74ANormal/considerableComplemented after 3 daysExperimentally produced, not pathogenic
p.F188LSeverely impairedNo complementationAnalogous to human mutation causing HHH syndrome
p.F188YSubstantialNo complementationExperimentally produced, shows transport-complementation discordance
p.S200KNormal/considerableComplemented after 3 daysExperimentally produced, not pathogenic
p.R275QSeverely impairedNo complementationAnalogous to human mutation causing HHH syndrome
p.R275KConsiderableComplemented after 5 daysExperimentally produced, shows how amino acid substitution type affects function

These studies reveal several important patterns:

  • Functional Domains: Mutations in certain regions (e.g., p.G27R, p.F188L, p.R275Q) consistently lead to severe functional defects, suggesting these amino acids are located in critical functional domains of the transporter.

  • Correlation with Disease: Mutations that severely impair ORT1 function typically correspond to pathogenic mutations in human SLC25A15 that cause HHH syndrome.

  • Transport-Complementation Discordance: Some mutations (e.g., p.F188Y) demonstrate substantial transport activity in liposome assays but fail to complement ORT1Δ yeast, highlighting the complexity of protein function in different experimental contexts .

  • Conservative vs. Non-conservative Substitutions: The functional impact can differ significantly based on the nature of the amino acid substitution. For example, p.R275Q (arginine to glutamine) severely impairs function, while p.R275K (arginine to lysine, a more conservative change) retains considerable activity .

How do complementation assays with ORT1 help understand pathogenic mutations?

Complementation assays using ORT1-deficient yeast (ORT1Δ) have emerged as a powerful tool for evaluating the functional consequences of mutations in ornithine transporters. These assays provide several advantages for understanding pathogenic mutations:

  • Physiological Context: Unlike in vitro transport assays, complementation studies assess protein function in a living cellular environment, accounting for factors such as protein folding, stability, and trafficking to the mitochondria.

  • Clear Phenotypic Readout: ORT1Δ yeast strains exhibit arginine auxotrophy (inability to grow on media lacking arginine). The rescue of this phenotype by introducing wild-type or mutant ORT1 provides a straightforward measure of functional capacity.

  • Quantitative Assessment: The degree of complementation can be quantified by measuring growth rates in liquid culture or colony size on solid media, allowing for the classification of mutations as mild, moderate, or severe.

  • Validation of Disease Causality: By testing mutations identified in patients with HHH syndrome, complementation assays help establish whether these genetic variants are truly pathogenic or merely benign polymorphisms.

The standard complementation protocol involves:

  • Transforming ORT1Δ yeast with expression vectors containing wild-type or mutant ORT1

  • Selecting transformants on appropriate media

  • Testing growth on arginine-less synthetic complete medium

  • Monitoring growth over 3-5 days, with observations typically at days 3 and 5

Research has shown that complementation assays and transport measurements sometimes yield discordant results. For instance, the experimentally produced p.F188Y mutation displayed substantial transport activity in liposome assays but failed to complement ORT1Δ cells in both liquid and solid media. This discrepancy highlights the importance of using multiple methodological approaches for a comprehensive functional evaluation .

For the most accurate assessment of mutation pathogenicity, it is recommended to combine complementation assays with direct measurements of transport activity, as this dual approach provides the most reliable distinction between disease-causing mutations and benign variants .

What are common issues in reconstituting ORT1 in liposomes?

Reconstituting ORT1 in liposomes for transport assays presents several technical challenges that researchers should anticipate and address:

  • Protein Denaturation:

    • Issue: Membrane proteins like ORT1 are prone to denaturation during purification and reconstitution.

    • Solution: Maintain optimal detergent concentrations throughout the purification process. Use stabilizing agents such as glycerol (5-10%) and avoid freeze-thaw cycles. Consider adding specific lipids that may stabilize the protein structure.

  • Inconsistent Reconstitution Efficiency:

    • Issue: Variable incorporation of ORT1 into liposomes between experiments affects reproducibility.

    • Solution: Standardize the protein-to-lipid ratio (typically 1:100 w/w) and use consistent reconstitution methods. Verify protein incorporation by SDS-PAGE analysis of recovered liposomes or by freeze-fracture electron microscopy.

  • Non-specific Leakage:

    • Issue: Liposomes may develop leaks that allow substrate exchange independent of ORT1 activity.

    • Solution: Include protein-free liposomes as controls in all experiments. Optimize lipid composition (typically phosphatidylcholine:phosphatidylethanolamine at 4:1) and size (uniform 100-200 nm diameter liposomes prepared by extrusion).

  • Orientation of Reconstituted Protein:

    • Issue: ORT1 may insert into liposomes in both inward and outward orientations.

    • Solution: Assess the proportion of correctly oriented protein using protease protection assays or antibody-based techniques. Account for bidirectional transport in kinetic calculations.

  • Background Signal:

    • Issue: High background in transport measurements due to substrate binding to liposomes or filters.

    • Solution: Include appropriate controls (valinomycin-treated liposomes, zero-time points) and optimize washing procedures for filters used to separate liposomes from external medium.

Table 3: Troubleshooting Guide for ORT1 Liposome Reconstitution

IssuePossible CauseSolution
Low protein yieldProtein aggregation during expressionLower induction temperature (16-20°C)
Inefficient extractionOptimize detergent type and concentration
Poor reconstitutionIncompatible detergentTry different detergents (DDM, Triton X-100)
Suboptimal lipid compositionAdjust phospholipid ratios
No transport activityDenatured proteinInclude stabilizing agents during purification
Incorrect buffer conditionsOptimize pH, salt concentration
High backgroundNon-specific bindingIncrease washing steps, add competitive inhibitors
Liposome leakageVerify liposome integrity, optimize preparation

How should ORT1 protein be stored and handled for optimal activity?

Proper storage and handling of ORT1 protein are critical for maintaining its functional integrity and ensuring reliable experimental results:

  • Short-term Storage:

    • For working aliquots, store at 4°C for up to one week to minimize protein denaturation.

    • Add stabilizing agents such as glycerol (final concentration 5-10%) to maintain protein solubility.

  • Long-term Storage:

    • Store at -20°C/-80°C with added cryoprotectants such as glycerol (final concentration 20-50%).

    • Aliquot the protein solution into small volumes to avoid repeated freeze-thaw cycles.

    • Flash-freeze in liquid nitrogen before transferring to long-term storage.

  • Reconstitution of Lyophilized Protein:

    • Centrifuge the vial briefly before opening to bring contents to the bottom.

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

    • Add glycerol to a final concentration of 6-50% for stability.

  • Buffer Composition:

    • Optimal buffer for ORT1 is typically Tris/PBS-based with pH 8.0.

    • Include 6% trehalose as a stabilizing agent for both liquid and lyophilized forms.

  • Handling Precautions:

    • Avoid repeated freeze-thaw cycles as these significantly reduce protein activity.

    • Keep the protein at 4°C during experiments rather than room temperature.

    • Minimize exposure to oxidizing conditions by including reducing agents like DTT or β-mercaptoethanol (0.5-1 mM) in working solutions.

    • Handle the protein gently to avoid denaturation through mechanical stress.

Following these storage and handling guidelines can significantly improve the consistency and reliability of experimental results when working with recombinant ORT1 protein .

What controls are essential when performing ORT1 complementation studies?

Rigorous controls are essential for ensuring the validity and interpretability of ORT1 complementation studies:

  • Positive Controls:

    • Wild-type ORT1 expression vector: Demonstrates maximum complementation potential

    • Known functional variants: Provides reference points for partial activity

    • Positive growth control: Arginine-supplemented media to verify viability of all strains

  • Negative Controls:

    • Empty vector: Accounts for potential growth due to leaky expression or spontaneous reversion

    • Known non-functional ORT1 variants: Establishes the baseline for lack of complementation

    • Growth monitoring in the absence of selection (arginine-supplemented medium) to ensure equal viability

  • Experimental Validation Controls:

    • Verification of expression levels: Western blot analysis to confirm comparable expression of wild-type and mutant proteins

    • Subcellular localization: Immunofluorescence or fractionation studies to verify proper targeting to mitochondria

    • Multiple independent transformants: Testing several clones to account for clonal variation

  • Methodological Controls:

    • Time course measurements: Observations at multiple time points (typically days 3 and 5) to detect delayed complementation

    • Multiple media formulations: Testing growth in liquid and solid media with varying nutritional compositions

    • Temperature sensitivity: Assessing growth at different temperatures (25°C, 30°C, 37°C) to detect conditional phenotypes

Table 4: Essential Controls for ORT1 Complementation Studies

Control TypePurposeImplementation
Expression verificationEnsure comparable protein levelsWestern blot with anti-ORT1 or anti-tag antibodies
LocalizationConfirm mitochondrial targetingMitochondrial fractionation or fluorescence microscopy
Growth conditionsDetect condition-dependent effectsVaried temperature, carbon source, pH
Technical replicatesEnsure reproducibilityMinimum of three independent experiments
Biological replicatesAccount for strain variationMultiple independently generated transformants
Growth kineticsDistinguish growth ratesGrowth curves in liquid culture (OD600 measurements)

What are the latest structural insights into ORT1?

Recent advances in structural biology techniques have significantly enhanced our understanding of ORT1's molecular architecture and transport mechanism:

  • Cryo-Electron Microscopy (Cryo-EM) Studies:

    • High-resolution structures of mitochondrial carrier proteins related to ORT1 have been obtained using cryo-EM, providing templates for homology modeling of ORT1

    • These structures reveal the characteristic six transmembrane helices arranged in a barrel-like configuration with pseudo-threefold symmetry

    • The substrate-binding site is located in the center of the carrier, with charged residues forming salt bridges that are disrupted during the transport cycle

  • Molecular Dynamics Simulations:

    • Computational studies have elucidated the conformational changes associated with substrate binding and transport

    • Simulations suggest that ORT1 alternates between cytoplasmic-facing and matrix-facing states through a rocker-switch mechanism

    • Key residues involved in substrate recognition have been identified through these analyses

  • Structure-Function Correlations:

    • Mapping of functionally characterized mutations onto structural models has identified critical regions for substrate binding and transport

    • Mutations affecting the conserved signature motifs of mitochondrial carriers (PX[D/E]XX[K/R]) consistently disrupt function

    • The importance of salt bridge networks in stabilizing specific conformational states has been established

  • Oligomeric State Analysis:

    • Although mitochondrial carriers were traditionally thought to function as monomers, recent evidence suggests ORT1 may form functional dimers or higher-order oligomers

    • Cross-linking studies and native gel electrophoresis have provided evidence for dimeric assemblies

    • The functional significance of oligomerization remains an active area of investigation

These structural insights have profound implications for understanding the molecular basis of HHH syndrome and for the rational design of therapeutic interventions targeting defective ornithine transport.

How is ORT1 being used to understand mitochondrial transport mechanisms?

ORT1 has emerged as a model system for investigating the general principles governing mitochondrial transport mechanisms:

  • Transport Kinetics and Energetics:

    • ORT1-reconstituted liposomes are being used to determine the precise kinetic parameters (Km, Vmax) of ornithine/citrulline exchange

    • Studies are examining whether transport is electrogenic (net charge movement) or electroneutral

    • The coupling between substrate transport and the mitochondrial membrane potential is being characterized

  • Substrate Recognition and Specificity:

    • Structure-guided mutagenesis is revealing the molecular determinants of substrate specificity

    • Competition assays with structural analogs of ornithine and citrulline are mapping the chemical requirements for substrate recognition

    • The substrate binding pocket is being characterized through photolabeling and chemical modification techniques

  • Transport Cycle Intermediates:

    • Time-resolved techniques are being applied to capture transient conformational states during the transport cycle

    • Inhibitors that trap specific conformational states are being identified and characterized

    • Site-directed spin labeling and EPR spectroscopy are providing insights into the dynamics of substrate-induced conformational changes

  • Regulation of Transport Activity:

    • Post-translational modifications (phosphorylation, acetylation) that modulate ORT1 activity are being identified

    • The impact of membrane lipid composition on transport efficiency is being systematically investigated

    • Protein-protein interactions that might regulate ORT1 function are being characterized through pull-down and co-immunoprecipitation studies

These fundamental studies on ORT1 are establishing general principles that apply to the broader family of mitochondrial carrier proteins, contributing to our understanding of cellular metabolism and bioenergetics.

What are unexplored areas of ORT1 research?

Despite significant advances in ORT1 research, several critical areas remain underexplored, presenting opportunities for innovative investigations:

  • In vivo Dynamics and Regulation:

    • The real-time dynamics of ORT1 transport in living cells remains poorly characterized

    • Regulatory mechanisms that adjust ORT1 activity in response to metabolic demands are largely unknown

    • The turnover rate and factors controlling the degradation of ORT1 have not been systematically investigated

  • Interaction with Other Mitochondrial Proteins:

    • Potential functional coupling between ORT1 and other components of the arginine biosynthesis pathway

    • Interactions with the mitochondrial import machinery and quality control systems

    • Formation of metabolons (multienzyme complexes) involving ORT1 and related metabolic enzymes

  • Pathological Conditions Beyond HHH Syndrome:

    • Role of ORT1 orthologs in other metabolic disorders

    • Involvement in mitochondrial dysfunction associated with neurodegenerative diseases

    • Potential contributions to cancer metabolism through alterations in nitrogen handling

  • Novel Therapeutic Approaches:

    • Development of pharmacological chaperones to rescue misfolded but potentially functional ORT1 variants

    • Gene therapy strategies for ORT1-related disorders

    • Metabolic bypasses that could circumvent defective ornithine transport

  • Evolutionary Aspects:

    • The evolution of substrate specificity in the mitochondrial carrier family

    • Functional divergence of ornithine transporters across different eukaryotic lineages

    • Coevolution with metabolic pathways in different organisms

  • Advanced Methodological Approaches:

    • Application of single-molecule techniques to study the transport mechanism

    • Development of improved in vivo transport assays with greater physiological relevance

    • Creation of better cellular and animal models for studying ORT1-related disorders

Addressing these unexplored areas will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational methods. The insights gained from such studies will not only advance our understanding of ORT1 function but also contribute to broader knowledge of mitochondrial biology and metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.