Recombinant Saccharomyces cerevisiae Mitochondrial outer membrane protein IML2 (IML2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
IML2; YJL082W; J1007; Inclusion body clearance protein IML2; Increased minichromosome loss protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-731
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
IML2
Target Protein Sequence
MFRVFGSFGSKGNQSSGEEQSTKTKQVLKQANDFEIALKAMDFVLDDRTDEGLNLLKKAE METGSDQTILTLARGVIEFLQATLSFETEEMKRAAITLGKAEQMSWKSKQNAEKTNFRSS SIYPPGTVYAVTYTESCLLHALLMLFSESMMEAAKALLKLRRAYTMLQDIMVTVKKAERS KNSSSPSPSEKSQESCGSFVSAETTFISVDIPYKLSSEDKSNPLLLEFAEKIYTMRMGRL SGAHIGNTPSFHRLRDDLGLQTTPSQASDRHSVSDDFDLEQATIDEFIHSGANLCYGILQ VVLSLLPPAIGAVLSIVGFKGSREEGLRLVWKATKERNVHGCIGLLGLMFYYDGPFQFTD ADFDIPPNDNGSRALNKSRTNDSSLLPGYMDSATLLHPGKILEDALLKARALFPNSALWL LNEAKMLAGKGRLRDSLALMDSIDVNSIRMRQVKSLMVFERAILLVNLHEYNRAADDLIS LLDISDWSHALYTYFAGCCYLENWRMTQLGLLNDGKEQFYKERARELIFDAPSLLGKKTF KSKNLPLDRFMLRKVQQFNNMQKKLNLQEPLDSIATSPVHELAYFYNGYNRMTENDLILT KKMLTEYHNPAIDSEDPDQELIRNLLLSLTLRRLGDAERGLALLDDIVLPKIFYIQNGKV KYFKKTEDPWAYPAALYERALFCWKLGGMESLNECREWLLRAQNYAADYELSTRIGMKIK AALDRVENALA
Uniprot No.

Target Background

Function
IML2 is an inclusion body (IB) resident protein in *Saccharomyces cerevisiae* mitochondria that exhibits strong interaction with lipid droplet (LD) proteins. It plays a role in LD-mediated IB clearance following protein folding stress, likely by facilitating access to IBs of a LD-stored soluble sterol derivative acting as a chaperone in inclusion clearing.
Database Links

KEGG: sce:YJL082W

STRING: 4932.YJL082W

Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

Basic Research Questions

  • What is IML2 and what is its functional role in Saccharomyces cerevisiae?

    IML2 (Increased minichromosome loss protein 2) is a mitochondrial outer membrane protein in Saccharomyces cerevisiae. Functionally, IML2 is required for the clearance of inclusion bodies formed due to the accumulation of misfolded proteins . The protein is encoded by the IML2 gene, also known as SCY_2852 in some strain annotations .

    The full-length IML2 protein contains 731 amino acids and has multiple hydrophobic regions that facilitate its membrane integration. As a mitochondrial outer membrane component, IML2 plays a role in maintaining mitochondrial homeostasis, which is essential for cellular metabolism and energy production.

  • What methodologies are used to express recombinant IML2 in laboratory settings?

    Recombinant expression of IML2 in yeast typically involves these steps:

    • Vector Construction: For yeast surface display, GPI cell-surface display systems similar to those used for VP2 protein can be employed .

    • Yeast Transformation: Integration into the yeast genome similar to genome-integrated recombinant systems .

    • Expression Verification: Using immunofluorescence assays (IFA) to detect protein localization on yeast cells, as demonstrated with other recombinant proteins .

    • Protein Detection: Techniques like confocal microscopy following incubation with appropriate antibodies (e.g., anti-His-tag antibodies followed by FITC-conjugated secondary antibodies) .

    For high-level expression of mitochondrial membrane proteins, researchers often employ:

    • Regulated promoters like GAL promoters to control expression timing

    • Fusion tags for easier detection and purification (His-tags are commonly used)

    • Optimized growth conditions (temperature, media composition)

  • How can researchers verify the correct localization of recombinant IML2 to the mitochondrial outer membrane?

    Verification of proper IML2 localization can be achieved through:

    1. Subcellular Fractionation: Isolating highly purified mitochondrial outer membranes following protocols similar to those used in comprehensive mitochondrial proteome characterization studies .

    2. Immunofluorescence Microscopy: Using specific antibodies against IML2 or attached epitope tags, similar to the approach described for yeast surface display systems :

      • Fix cells with paraformaldehyde (typically 4%)

      • Incubate with primary antibodies (e.g., anti-His-tag)

      • Detect using fluorescently labeled secondary antibodies

      • Visualize using confocal microscopy

    3. Co-localization Studies: Using established mitochondrial outer membrane markers alongside IML2 to confirm proper targeting.

    4. Protease Protection Assays: Determining the membrane topology of IML2 by testing its accessibility to proteases before and after membrane permeabilization.

Advanced Research Questions

  • What approaches can be used to study IML2's role in protein quality control and inclusion body clearance?

    To investigate IML2's function in protein quality control:

    1. Gene Deletion/Knockout Studies:

      • Create IML2 deletion strains using homologous recombination techniques

      • Examine phenotypic effects on inclusion body formation using fluorescent protein aggregation reporters

      • Assess cell viability under conditions that promote protein misfolding (heat shock, chemical stress)

    2. Proteomics Approaches:

      • Compare the mitochondrial proteome in wild-type and IML2-deficient strains

      • Identify accumulating misfolded proteins in IML2 mutants

      • Use stable isotope labeling techniques to measure protein turnover rates

    3. Stress Response Analysis:

      • Examine expression of stress-responsive genes like those induced by NP exposure

      • Analyze autophagy-related gene expression (ATG7, ATG34, ATG39, ATG40) which may correlate with inclusion body management

      • Monitor cell wall integrity pathways that may be activated during proteotoxic stress

  • How does IML2 integrate into the broader mitochondrial protein import and assembly network?

    IML2 likely interfaces with established mitochondrial membrane protein assembly pathways:

    1. Interaction with Import Machinery:

      • May interact with components of mitochondrial import machinery (MIM) complex, which facilitates insertion of outer membrane proteins

      • Could participate in lateral release processes similar to those mediated by TIM23 complexes for inner membrane proteins

    2. Assembly Pathway Analysis:

      • Experimental approaches would mirror those used for other membrane proteins:

        • Blue native PAGE to identify native complexes containing IML2

        • Crosslinking studies to capture transient interactions

        • Pull-down assays with tagged versions of IML2

    3. Integration with Quality Control Systems:

      • May function similarly to Ubx2, which operates in quality control by removing stalled precursors

      • Could be part of pathways involving other quality control factors like Pam18 and Mgr2

  • What genetic approaches are most effective for studying IML2 function in synthetic recombinant yeast populations?

    For genetic analysis of IML2 in synthetic recombinant populations:

    1. Outcrossing Cycles Impact:

      • Studies show that 12 consecutive cycles of intentional outcrossing can generate significant genetic diversity

      • Each outcrossing cycle includes sporulation, spore isolation, and mating

      • Approximately 15-20 asexual generations occur between outcrossing cycles

    2. Genotypic Analysis:

      • Genome sequencing at different timepoints (initial, cycle 6, cycle 12)

      • SNP identification to track genetic changes

      • Haplotype frequency estimation from Pool-SEQ data

  • What experimental methodologies can assess how IML2 responds to cellular stressors?

    To evaluate IML2's response to stressors:

    1. Protein Stability and Modification Studies:

      • Pulse-chase experiments to measure protein turnover rates under stress

      • Western blot analysis to detect post-translational modifications

      • Fluorescent tagging to monitor localization changes during stress

    2. Genetic Interaction Screening:

      • Synthetic genetic array (SGA) analysis under stress conditions

      • Identify genes that become essential in IML2-deficient cells during stress

      • Screen for suppressors of IML2 deletion phenotypes

  • How can immunological techniques be applied to study recombinant IML2 in various experimental systems?

    Advanced immunological approaches include:

    1. Yeast-Based Vaccine Development Framework:
      Similar to approaches used with recombinant S. cerevisiae expressing viral antigens :

      • Surface display systems for proper presentation of IML2 or IML2 domains

      • Immunization protocols similar to those used for yeast-CEA studies :

        • Multiple administrations (e.g., 4 immunizations at 1-week intervals)

        • Dose optimization (e.g., 1×10⁹ CFU per mouse)

      • Immune response measurement:

        • Detection of specific antibodies via ELISA

        • Analysis of T-cell responses (CD4+ and CD8+)

    2. Epitope Mapping:

      • Creating truncated versions of IML2 to identify immunogenic regions

      • Peptide array analysis for comprehensive epitope identification

      • Phage display libraries to identify antibody binding sites

    3. Cross-Reactivity Studies:

      • Testing antibodies against related proteins to assess specificity

      • Evaluating conservation between yeast IML2 and homologs in other species

      • Developing IML2-specific monoclonal antibodies for research applications

  • What computational approaches can predict IML2 structure-function relationships?

    Computational methods for analyzing IML2 include:

    1. Structural Prediction:

      • Secondary structure prediction based on amino acid sequence

      • Transmembrane domain identification using algorithms like TMHMM

      • Homology modeling using related proteins with known structures

      • Ab initio modeling for unique domains

    2. Functional Domain Analysis:

      • Motif identification using databases like PROSITE

      • Conservation analysis across species to identify functionally important regions

      • Molecular dynamics simulations to predict protein flexibility and interaction sites

    3. Interaction Prediction:

      • Protein-protein interaction predictions based on sequence and structural features

      • Docking simulations with potential binding partners

      • Network analysis to place IML2 in broader mitochondrial protein interaction networks

    4. AI-Assisted Research Tools:
      Several AI tools can assist in IML2 research :

      • Consensus: For generating summaries of scientific literature about IML2

      • Elicit.org: Finding relevant papers without perfect keyword matches

      • Scite.ai: Providing citations with information about whether claims have been supported or refuted

      • ChatPDF: For analyzing research papers on IML2 and extracting relevant information

  • How can heterologous expression systems be optimized for functional studies of IML2?

    Optimizing heterologous expression requires addressing several challenges:

    1. Expression System Selection:

      • S. cerevisiae: Good for functional studies in native environment

      • E. coli: Potentially challenging for membrane proteins but allows high yield

      • Insect cells: Better for eukaryotic membrane proteins requiring post-translational modifications

    2. Expression Optimization Strategies:

      • Codon optimization for the host organism

      • Use of fusion partners to enhance solubility and stability

      • Inducible promoters for controlled expression

      Expression ParameterOptimization ApproachExpected Outcome
      TemperatureLower temperature (20-25°C)Reduced aggregation
      Induction timingInduction at mid-log phaseBalance between cell density and protein production
      Media compositionRich vs. minimal mediaDifferent folding environments
      Fusion tagsN-terminal vs. C-terminalImpact on membrane insertion
    3. Functional Verification Methods:

      • Complementation assays in IML2-deficient yeast strains

      • Activity assays specific to the predicted function

      • Binding studies with potential interacting partners

      • Localization studies to confirm proper membrane targeting

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.