Recombinant Saccharomyces cerevisiae Mitochondrial outer membrane protein SCY_3392 (SCY_3392)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SCY_3392; IML2-like protein SCY_3392; YKR018C homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-725
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
SCY_3392
Target Protein Sequence
MFKVFGFGAKEEIPELSQEEKTKAILKQAHDFEQALRAMDYVLDDNADEGLALLDESDAK EASDQTINALARGVIEFLEATLGFEAEEMKKASATLAKAEALSLKSRERAQKIGLKSSSL YPPGTVYAVTYTESCLLHALLMIFSESMMEAAKAILKLRKSYYMLQEILETIKAANKAKK LKITSGSEDKESTPATFITGGDAFNSVDIPYELTPEEQKDKDLLQFAEQIHSMRTKRLSG AHIGNSPAINRLRGELGLQAMEDLPEEEITDHKVLSDDIDLSQATIDEFVHSGVNLCFGI LQVVISLLPPAIGAVLSVVGFRGSREEGLRLVWKATKQRNVHGCIGLLALMFYYDGPFQF TDDDFDIPAAVKDSSNSEDSEDEEMDGPTLLHPGKILEDALLQSRALFPNSALWLLNEAR MLSGKGRLEEAVALMDSIDVSKIRMRQVKSLMIFDRAITLIHLHQYDRAAEDILSLLDIS DWSHAFYTYFAGCCYLENWRMCEMGLMKSDKKDEYQKKAEELIFTSVNLLGKKTFKSKNL PLDRFILRKVEQFKAKKEELGVENPLDGIATSPVHEISYFYNGYNRMSEEHLELTKKMLT EYRNPAIEALDSDQELIKDLLVSLTLRRLGHIQEGCDILDEKVLPKFFSIQNGKVKYIKK TEDPWAYPTALYERALFTWKLEGMDGLPESKEWLLRAQGYADDYELSTRVGMKIKAAIDR VDHSL
Uniprot No.

Target Background

Function
May be involved in maintaining mitochondrial DNA stability.
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is the biological origin and structural characteristics of SCY_3392?

SCY_3392 is a mitochondrial outer membrane protein derived from Saccharomyces cerevisiae strain YJM789 (Baker's yeast). The protein has been assigned UniProt accession number A6ZZY2. The commercially available recombinant form is produced using a baculovirus expression system, which enables proper folding and post-translational modifications similar to those observed in eukaryotic systems. The recombinant version is typically supplied as a partial protein rather than the full-length sequence .

Based on research into similar mitochondrial outer membrane proteins in yeast, SCY_3392 likely contains transmembrane domains that anchor it to the mitochondrial outer membrane, with a significant portion of the protein (particularly the carboxyl-terminal domain) facing the cytosol. This orientation is similar to that of MMM1, another well-characterized mitochondrial outer membrane protein that plays a crucial role in maintaining mitochondrial morphology .

What are the recommended storage conditions for preserving SCY_3392 stability?

The stability and shelf life of SCY_3392 depend on multiple factors including storage temperature, buffer composition, and protein formulation. According to product specifications, the protein preparation should be handled as follows:

  • Lyophilized form: Stable for approximately 12 months when stored at -20°C to -80°C

  • Liquid form: Stable for approximately 6 months when stored at -20°C to -80°C

  • Working aliquots: Can be stored at 4°C for up to one week

  • Repeated freezing and thawing cycles should be strictly avoided as they compromise protein integrity

For long-term storage of reconstituted protein, it is recommended to prepare aliquots containing 5-50% glycerol (final concentration) before storing at -20°C or -80°C. The standard recommended glycerol concentration is 50%, which provides optimal cryoprotection while maintaining protein functionality .

What is the recommended reconstitution protocol for experimental applications?

To properly reconstitute lyophilized SCY_3392 for experimental use, follow this methodological approach:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the container

  • Reconstitute the protein in deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

  • For preparations intended for long-term storage, add glycerol to a final concentration of 5-50% (typically 50%)

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Validate protein activity after reconstitution using appropriate functional assays

The choice of buffer system can significantly impact protein stability and should be optimized based on the specific experimental requirements and downstream applications.

What analytical methods are appropriate for confirming SCY_3392 purity and integrity?

Commercial preparations of SCY_3392 typically achieve a purity of >85% as determined by SDS-PAGE analysis . Researchers should independently verify protein integrity using multiple analytical approaches:

  • SDS-PAGE with Coomassie or silver staining to confirm molecular weight and assess purity

  • Western blotting with tag-specific or protein-specific antibodies

  • Mass spectrometry for precise molecular weight determination and detection of potential degradation products

  • Size exclusion chromatography to evaluate aggregation state

  • Circular dichroism spectroscopy to assess secondary structure integrity

Since the protein is expressed with a tag (although the specific tag type may vary by manufacturer), tag-based detection and purification methods can be employed for further validation .

What transformation approaches are most effective for studying SCY_3392 in yeast systems?

For studying SCY_3392 in yeast systems, selecting the appropriate transformation method is crucial. Recent advancements in yeast transformation techniques offer significant improvements in both efficiency and precision:

The dual heat-shock and electroporation approach (HEEL) has been shown to dramatically improve transformation quality by increasing the percentage of mono-transformed yeast cells from approximately 20% to over 70%. This method allows for nearly perfect phenotype-to-genotype associations, which is critical when studying the specific functions of SCY_3392 .

Key methodological considerations include:

  • For high-throughput library creation: The HEEL method enables transformation of more than 10^7 yeast cells per reaction with a circular plasmid, representing a nearly 100-fold improvement over conventional transformation methods

  • For precise phenotype-to-genotype mapping: Implement a dual-barcode design using both SNP markers and high-diversity regions to allow robust identification of unique genotypes

  • For single-variant analysis: Standard lithium acetate transformation may be sufficient, but attention to transformation efficiency and proper controls remains essential

What functional assays are appropriate for characterizing SCY_3392 activity?

Based on studies of analogous mitochondrial outer membrane proteins like MMM1, several functional assays can be employed to characterize SCY_3392:

  • Mitochondrial morphology assessment:

    • Fluorescence microscopy using mitochondria-specific dyes (e.g., MitoTracker)

    • Expression of mitochondria-targeted fluorescent proteins

    • Quantitative analysis of mitochondrial shape, size, and distribution

  • Mitochondrial segregation and inheritance analysis:

    • Time-lapse microscopy to track mitochondrial movement during cell division

    • Quantification of mitochondrial distribution between mother and daughter cells

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction analysis

  • Respiratory function assessment:

    • Growth assays on fermentable versus non-fermentable carbon sources

    • Oxygen consumption rate measurement

    • Activity assays for respiratory chain complexes

How should genetic modification approaches be optimized when studying SCY_3392 function?

When designing genetic modifications to study SCY_3392 function, consider the following methodological framework:

  • Gene disruption strategies:

    • Complete gene knockout to assess essentiality and global functional impact

    • Domain-specific mutations to identify critical functional regions

    • Temperature-sensitive alleles to enable conditional inactivation

    • Auxin-inducible degron tagging for temporal control of protein depletion

  • Expression optimization:

    • Use of native promoter for physiologically relevant expression levels

    • Inducible promoter systems (GAL1, CUP1) for controlled expression

    • Integration at the native locus versus plasmid-based expression

  • Tagging considerations:

    • C-terminal versus N-terminal tagging based on predicted topology

    • Selection of small epitope tags to minimize functional interference

    • Inclusion of flexible linker sequences between the protein and tag

  • Control constructs:

    • Wild-type SCY_3392 expressed under identical conditions

    • Related mitochondrial membrane proteins as comparative controls

    • Empty vector controls for plasmid-based expression systems

What growth conditions are optimal for phenotypic analysis of SCY_3392 function?

Based on studies of mitochondrial outer membrane proteins like MMM1, the following growth conditions are recommended for phenotypic analysis of SCY_3392:

Growth ParameterRecommended ConditionRationale
Carbon sourceGlucose (fermentable) and glycerol/ethanol (non-fermentable)Comparison allows assessment of respiratory function
Temperature30°C (standard), 37°C (stress)Higher temperature may exacerbate phenotypes
Growth phaseLog phase and stationary phaseMitochondrial morphology changes with growth phase
Media supplementsSupplementation with or without amino acidsMay affect mitochondrial biogenesis
Osmotic stressStandard and high osmolarityMay reveal conditional phenotypes
Oxidative stressH₂O₂ or menadione exposureTests mitochondrial stress response

Based on analysis of similar mitochondrial membrane proteins, mutants defective in SCY_3392 function may show:

  • Temperature-sensitive growth defects

  • Inability to grow on non-fermentable carbon sources

  • Abnormal mitochondrial morphology

  • Defects in mitochondrial inheritance during cell division

How does SCY_3392 relate to the broader mitochondrial membrane protein network?

SCY_3392 should be considered in the context of the extensively studied mitochondrial membrane protein network. Comparative analysis with well-characterized proteins such as MMM1 can provide valuable insights:

MMM1, a mitochondrial outer membrane protein in Saccharomyces cerevisiae, has been established as critical for maintaining the elongated shape of mitochondria. In mmm1 mutants, mitochondria collapse into large, spherical organelles at restrictive temperatures, with this phenotype being reversible upon return to permissive conditions. The lethality observed in mmm1 mutants when grown on non-fermentable carbon sources appears to result from defects in mitochondrial segregation during cell division .

Based on these findings, investigation of SCY_3392 should explore:

  • Potential functional relationships with MMM1 and other mitochondrial morphology maintenance proteins

  • Possible involvement in connecting mitochondria to cytoskeletal elements

  • Role in mitochondrial segregation and inheritance mechanisms

  • Contribution to maintaining mitochondrial membrane architecture

  • Interaction with other protein complexes that span or associate with the mitochondrial outer membrane

Research approaches should include suppressor screens, synthetic genetic array analysis, and systematic protein-protein interaction mapping to position SCY_3392 within the mitochondrial protein interaction network .

What advanced microscopy techniques are most informative for studying SCY_3392 localization and dynamics?

To comprehensively analyze SCY_3392 localization and dynamics, researchers should employ multiple complementary microscopy approaches:

  • Super-resolution microscopy techniques:

    • Structured illumination microscopy (SIM) - Achieves resolution of ~100 nm

    • Stimulated emission depletion (STED) microscopy - Resolution below 50 nm

    • Single-molecule localization microscopy (PALM/STORM) - Nanometer-scale precision

  • Live-cell imaging approaches:

    • Spinning disk confocal microscopy for rapid multiposition acquisition

    • Light sheet microscopy for reduced phototoxicity during long-term imaging

    • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence localization with ultrastructural context

    • Immunogold labeling for transmission electron microscopy

    • Cryo-electron tomography for 3D ultrastructural analysis

  • Quantitative image analysis:

    • 3D reconstruction of mitochondrial networks

    • Automated segmentation and morphological analysis

    • Single-particle tracking for dynamic behavior

    • Colocalization analysis with other mitochondrial markers

These techniques can reveal SCY_3392 distribution patterns, potential segregation into specialized membrane domains, dynamic behavior during mitochondrial fission/fusion events, and redistribution in response to cellular stresses .

How can high-throughput methods be applied to comprehensively characterize SCY_3392 function?

High-throughput approaches enable systematic characterization of SCY_3392 function and interactions:

  • Automated genotype-to-phenotype mapping:
    Using the dual-barcode design approach described in recent literature, researchers can create and analyze large libraries of SCY_3392 variants. This method employs both SNP markers and high-diversity regions to enable robust identification and quantification of unique genotypes within heterogeneous populations using standard Sanger sequencing .

  • Systematic genetic interaction screening:

    • Synthetic genetic array (SGA) analysis

    • Transposon-based approaches (e.g., SATAY)

    • CRISPR interference screens

  • High-throughput protein interaction mapping:

    • Protein-fragment complementation assays

    • Pooled mass spectrometry approaches

    • Parallel analysis of protein localization using GFP fusion libraries

  • Multiparametric phenotypic profiling:

    • Automated microscopy with machine learning-based image analysis

    • Flow cytometry with multiple mitochondrial functional reporters

    • Metabolomic profiling under various genetic and environmental conditions

High-Throughput MethodKey AdvantagesLimitationsData Output
HEEL transformationHigh efficiency with mono-transformationRequires specialized equipmentLibrary size >10^7 with 70% mono-transformed cells
Dual-barcode designPrecise genotype identificationRequires barcoding strategyAccurate phenotype-to-genotype mapping
SGA analysisGenome-wide genetic interactionsLabor intensiveGenetic interaction network
Protein-fragment complementationIn vivo protein interactionsPotential false positivesBinary interaction map
Automated microscopyQuantitative morphological dataComplex image analysisMultidimensional phenotypic profiles

These approaches can be combined to create comprehensive functional models of SCY_3392 within the broader context of mitochondrial biology .

What computational approaches are valuable for predicting SCY_3392 structural features and interactions?

Advanced computational methods can provide important insights into SCY_3392 structure and function:

  • Structural prediction approaches:

    • AlphaFold2 and RoseTTAFold for protein structure prediction

    • Molecular dynamics simulations to model membrane integration

    • Transmembrane domain prediction algorithms (TMHMM, Phobius)

    • Ab initio modeling of domains lacking structural homologs

  • Interaction prediction methods:

    • Co-evolutionary analysis to identify potential interaction interfaces

    • Molecular docking with candidate interaction partners

    • Network-based inference using known mitochondrial protein interactions

    • Sequence-based prediction of post-translational modification sites

  • Evolutionary analysis:

    • Phylogenetic profiling across fungal species

    • Identification of conserved functional motifs

    • Positive selection analysis to identify adaptively evolving regions

    • Paralog analysis for functional divergence

  • Systems biology integration:

    • Network analysis incorporating transcriptomic and proteomic data

    • Flux balance analysis to predict metabolic impacts

    • Bayesian network modeling of mitochondrial functional relationships

    • Integration with yeast genetic interaction networks

These computational approaches should be iteratively combined with experimental validation to build comprehensive models of SCY_3392 function within mitochondrial biology.

What are common sources of experimental variability when working with SCY_3392, and how can they be addressed?

Several factors can introduce variability in SCY_3392 experiments:

  • Protein preparation inconsistencies:

    • Batch-to-batch variation in recombinant protein production

    • Incomplete reconstitution or improper handling

    • Protein degradation during storage or experiment

    Solution: Implement rigorous quality control testing of each protein batch, including SDS-PAGE, activity assays, and circular dichroism. Prepare single-use aliquots to avoid freeze-thaw cycles .

  • Transformation efficiency variation:

    • Inconsistent competent cell preparation

    • Variable DNA quality

    • Environmental factors affecting transformation

    Solution: Adopt standardized protocols like HEEL that can achieve consistently high transformation efficiency (>10^7 transformants/μg DNA) with high mono-transformation rates (>70%) .

  • Expression level differences:

    • Promoter variability

    • Plasmid copy number fluctuation

    • Growth condition variations

    Solution: Use genomic integration at a defined locus rather than plasmid-based expression when possible. Alternatively, implement internal controls and normalize expression levels using quantitative Western blotting.

  • Phenotypic assessment subjectivity:

    • Observer bias in microscopic analysis

    • Inconsistent scoring criteria

    • Manual counting errors

    Solution: Employ automated image acquisition and analysis workflows with objective, quantitative parameters for phenotypic classification.

How should contradictory results regarding SCY_3392 function be reconciled?

When faced with contradictory results regarding SCY_3392 function, implement this systematic approach to reconciliation:

  • Methodological comparison:

    • Identify differences in experimental approaches

    • Evaluate protein tagging strategies (position, size, type of tag)

    • Compare growth conditions and strain backgrounds

    • Assess expression levels and potential overexpression artifacts

  • Cross-validation with multiple techniques:

    • Confirm findings using orthogonal experimental approaches

    • Combine genetic, biochemical, and microscopic methods

    • Validate key observations in different strain backgrounds

    • Test under various environmental conditions

  • Genetic interaction profiling:

    • Perform epistasis analysis with related genes

    • Create double mutants to identify functional relationships

    • Conduct suppressor screens to identify compensatory pathways

  • Consider context-dependent functions:

    • Evaluate results in relation to metabolic state

    • Test for condition-specific phenotypes

    • Examine cell-cycle dependent effects

    • Assess chronological and replicative age influences

This systematic approach can help distinguish primary functions from secondary effects and resolve apparent contradictions in experimental results.

What statistical approaches are most appropriate for analyzing SCY_3392 experimental data?

The appropriate statistical analysis depends on the experimental design and data type:

  • For growth assays:

    • Area under the curve (AUC) analysis for growth curves

    • Two-way ANOVA to assess interaction between genotype and growth conditions

    • Post-hoc tests (Tukey's HSD) for multiple comparisons

    • Mixed-effects models for experiments with repeated measurements

  • For microscopy data:

    • Non-parametric tests for morphological classifications

    • Kolmogorov-Smirnov test for distribution comparisons

    • Principal component analysis for multiparametric morphological data

    • Hierarchical clustering for identifying phenotypic groups

  • For high-throughput screens:

    • False discovery rate control using Benjamini-Hochberg procedure

    • Gene set enrichment analysis for functional interpretation

    • Network analysis methods for interaction data

    • Bayesian approaches for integrating multiple data types

  • For protein interaction studies:

    • Statistical significance calculation for co-immunoprecipitation

    • Permutation tests for network analysis

    • Enrichment analysis for interaction partners

    • Correlation analysis for co-localization studies

Analysis TypeRecommended Statistical MethodAppropriate Sample SizeKey Considerations
Growth comparisonTwo-way ANOVA with repeated measuresMinimum n=3 biological replicatesTest normality assumptions
Morphology quantificationNon-parametric Mann-Whitney U test>100 cells per conditionBlind scoring to prevent bias
Protein interactionsSignificance analysis of interactome (SAINT)Multiple biological replicatesInclude appropriate controls
High-throughput screenRobust Z-score with FDR correctionDepends on library sizeInclude positive/negative controls

What strategies are most effective for troubleshooting failed SCY_3392 experiments?

When troubleshooting failed experiments with SCY_3392, employ this systematic approach:

  • Protein quality verification:

    • Confirm protein purity by SDS-PAGE

    • Verify protein stability under experimental conditions

    • Test freshly prepared protein versus stored aliquots

    • Validate tag accessibility and functionality

  • Expression and localization confirmation:

    • Verify expression by Western blot

    • Confirm mitochondrial localization by subcellular fractionation

    • Use fluorescence microscopy to assess proper targeting

    • Check for aggregation or mislocalization

  • Strain and plasmid validation:

    • Sequence verify constructs before and after transformation

    • Test multiple independent transformants

    • Compare results across different strain backgrounds

    • Ensure no secondary mutations affect phenotypes

  • Methodological controls:

    • Include positive and negative controls for all assays

    • Perform control experiments with well-characterized proteins

    • Validate all reagents and equipment functionality

    • Test critical parameters with titration experiments

  • Systematic documentation:

    • Maintain detailed laboratory notebooks

    • Record all deviations from protocols

    • Document batch information for all reagents

    • Compare conditions between successful and failed experiments

This structured troubleshooting approach enables identification of technical issues versus genuine biological findings regarding SCY_3392 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.