Recombinant Saccharomyces cerevisiae Mitochondrial outer membrane protein YKR018C (YKR018C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
YKR018C; IML2-like protein YKR018C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-725
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YKR018C
Target Protein Sequence
MFKVFGFGAKEEIPELSQEEKTKAILKQAHDFEQALRAMDYVLDDNADEGLALLDESDAK EASDQTINALARGVIEFLEATLGFEAEEMKKASATLAKAEALSLKSRERAQKIGLKSSSL YPPGTVYAVTYTESCLLHALLMIFSESMMEAAKAILKLRKSYYMLQEILETIKAANKAKK LKITSGSEDKESTPATFITGGDAFNSVDIPYELTPEEQKDKDLLQFAEQIHSMRTERLSG AHIGNSPAINRLRGELGLQAMEDLPEEEITDHKVLSDDIDLSQATIDEFVHSGVNLCFGI LQVVISLLPPAIGAVLSVVGFRGSREEGLRLVWKATKQRNVHGCIGLLALMFYYDGPFQF TDDDFDIPAAVKDSSNSEDSEDEEMDGPTLLHPGKILEDALLQSRALFPNSALWLLNEAR MLSGKGRLEEAVALMDSIDVSKIRMRQVKSLMIFDRAITLIHLHQYDRAAEDILSLLDIS DWSHAFYTYFAGCCYLENWRMCEMGLMKSDKKDEYQKKAEELIFTSVNLLGKKTFKSKNL PLDRFILRKVEQFKAKKEELGVENPLDGIATSPVHEIAYFYNGYNRMSEEHLELTKKMLT EYRNPAIEALDSDQELIKDLLVSLTLRRLGHIQEGCDILDEKVLPKFFSIQNGKVKYIKK TEDPWAYPTALYERALFTWKLEGMDGLPESKEWLLRAQGYADDYELSTRVGMKIKAAIDR VDHSL
Uniprot No.

Target Background

Database Links

KEGG: sce:YKR018C

STRING: 4932.YKR018C

Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is the current knowledge about YKR018C's subcellular localization?

YKR018C primarily exhibits a dual localization pattern. Green fluorescent protein (GFP) fusion studies have demonstrated that the protein localizes to both the cytoplasm and nucleus under standard growth conditions . This dual localization suggests potential roles in both compartments and may indicate condition-dependent functions. When designing experiments to study YKR018C, researchers should consider this dual localization pattern and implement appropriate fractionation techniques to isolate and study the protein in its different cellular contexts.

What are the structural features of YKR018C?

While comprehensive structural data for YKR018C remains limited, it belongs to a protein family that includes its paralog IML2, which emerged following whole genome duplication in Saccharomyces cerevisiae . Researchers interested in structural analysis should consider comparative modeling approaches using related proteins. Techniques such as protein threading or homology modeling may provide initial structural insights prior to experimental determination through X-ray crystallography or cryo-EM methods. Functional predictions based on structural motifs could help guide experimental design for characterization studies.

How is YKR018C expression regulated in standard growth conditions?

According to the Saccharomyces Genome Database (SGD), there is currently no expression data available specifically for YKR018C under standard growth conditions . This knowledge gap presents an opportunity for researchers to characterize its expression profile through RNA-Seq or quantitative PCR approaches. When designing expression studies, researchers should compare YKR018C expression across various growth phases and media compositions. The lack of expression data in public repositories suggests that either YKR018C is expressed at low levels under standard conditions or that its expression is highly condition-specific.

What evidence exists for YKR018C's involvement in protein folding and stabilization?

Functional annotation analysis has linked YKR018C to protein folding and stabilization processes. Specifically, YKR018C clusters with YOR007C, YOR258W, and YDL091C in functional annotation studies with a significant p-value of 2.3633e-12 . This statistical association provides strong computational evidence for YKR018C's potential role in protein quality control mechanisms. To experimentally validate this function, researchers could employ techniques such as:

  • Co-immunoprecipitation with known chaperones

  • Thermal shift assays to assess effects on protein stability

  • Yeast deletion strain phenotyping under protein folding stress

  • Protein aggregation assays in YKR018C-deficient cells

How does YKR018C respond to DNA replication stress?

Current data indicates that YKR018C protein abundance increases in response to DNA replication stress . This stress-responsive behavior suggests a potential role in DNA damage tolerance or repair pathways. To further characterize this relationship, researchers should consider:

  • Time-course protein abundance measurements under various replication stressors (HU, MMS, UV)

  • Chromatin immunoprecipitation (ChIP) studies to determine if YKR018C associates with DNA during replication stress

  • Genetic interaction screening with known DNA replication and repair factors

  • Synchronized cell studies to assess cell-cycle dependent expression patterns

What techniques are most effective for studying YKR018C protein interactions?

Several biotinylation-based approaches have proven effective for studying protein interactions in Saccharomyces cerevisiae. The BioID2 and TurboID systems offer complementary approaches for capturing both stable and transient protein interactions . When studying YKR018C specifically, researchers should consider:

  • TurboID for rapid labeling (within minutes) of transient interactions

  • BioID2 for experiments requiring higher temperature conditions

  • Combination approaches to validate and cross-reference interaction datasets

  • Stringent controls to filter out non-specific biotinylation events

For YKR018C specifically, BioGRID data indicates an interaction with BRE1, which was detected using affinity capture techniques . This provides a valuable starting point for expanding the YKR018C interactome using more comprehensive approaches.

How can researchers address the challenge of studying proteins with unknown function like YKR018C?

When working with proteins of unknown function like YKR018C, a multi-faceted approach is recommended:

  • Comparative genomics across related yeast species to identify conserved domains

  • Systematic phenotypic screening of deletion/overexpression strains under various conditions

  • Protein-protein interaction mapping using complementary techniques

  • Integration of transcriptomic, proteomic, and metabolomic data

The recently developed biotinylation toolbox described in the literature offers promising approaches for functional characterization . These tools allow for high-throughput interaction profiling and characterization of protein functions across the entire yeast proteome. For YKR018C specifically, combining these interaction approaches with functional genomics screens would provide complementary datasets to infer function.

What is the relationship between YKR018C and its paralog IML2?

YKR018C shares evolutionary history with IML2, with both proteins arising from the whole genome duplication event in Saccharomyces cerevisiae . This paralogous relationship offers valuable research opportunities:

  • Comparative functional analysis to determine functional redundancy or specialization

  • Double knockout studies to identify synthetic genetic interactions

  • Domain swapping experiments to identify functionally important regions

  • Evolutionary rate analysis to assess selection pressures on each paralog

When designing such experiments, researchers should consider the potential for condition-specific functions that may not be apparent under standard laboratory conditions.

How can discretization methods improve gene expression analysis for YKR018C studies?

For genes like YKR018C, where expression patterns may be subtle or condition-dependent, appropriate discretization methods for gene expression data are crucial. The Gene Annotation Based Discretization (GABD) method has shown superior performance in capturing gene similarity compared to traditional approaches . This method determines discretization width by maximizing positive predictive value (PPV) computed using gene annotations.

When analyzing YKR018C expression data, researchers should consider:

  • Applying GABD to identify functionally relevant expression patterns

  • Comparing results with traditional methods like equal width discretization (EWD) or equal frequency discretization (EFD)

  • Using k-medoid clustering with appropriate discretization to predict functions of unclassified genes

  • Integrating multiple discretization approaches to ensure robust findings

As demonstrated in published research, GABD has shown PPV values of approximately 0.25 for RNA-seq yeast data, outperforming traditional methods that typically achieve values around 0.24 .

What are the recommended protocols for recombinant YKR018C expression and purification?

When expressing and purifying recombinant YKR018C, researchers should consider:

  • Expression system selection: While E. coli systems are common, expression in S. cerevisiae itself may preserve native post-translational modifications

  • Tag selection: For localization studies, C-terminal GFP fusions have been successful

  • Purification strategy: Affinity chromatography using epitope tags has proven effective for YKR018C interaction studies

  • Native conditions: Maintaining conditions that preserve protein-protein interactions if studying YKR018C complexes

When designing recombinant constructs, researchers should be mindful of potential effects of tags on protein localization and function, particularly given YKR018C's dual cytoplasmic/nuclear localization pattern.

How can researchers effectively study YKR018C in the context of transcriptional regulation?

The OriDB database contains information on transcription units in S. cerevisiae, which can be valuable for studying YKR018C regulation . When investigating transcriptional aspects, researchers should:

  • Analyze the YKR018C promoter region for regulatory elements

  • Consider chromosome position effects, as transcription can be influenced by chromosomal context

  • Use techniques like CRISPR-based transcriptional modulation to alter YKR018C expression

  • Employ reporter gene assays to study promoter activity under various conditions

Understanding transcriptional regulation will be particularly valuable given YKR018C's response to DNA replication stress, which likely involves transcriptional changes.

What genomic resources are available for studying YKR018C in different S. cerevisiae strains?

Different S. cerevisiae strains can exhibit genetic and phenotypic variation that may affect YKR018C function. The Broad Institute has developed resources for comparative genomics of S. cerevisiae strains, including the RM11-1a strain . When designing strain-comparative studies, researchers should:

  • Consider natural genetic variation between laboratory strains (e.g., S288C) and wild isolates (e.g., RM11-1a)

  • Utilize whole-genome sequencing data to identify strain-specific variations in YKR018C

  • Implement functional complementation assays between strains to assess functional conservation

  • Account for strain-specific differences in gene expression regulation

The sequence divergence between common laboratory strains and natural isolates (approximately 0.5-1%) may reveal important functional insights about YKR018C evolution and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.