Recombinant Saccharomyces cerevisiae Mitochondrial phosphate carrier protein (MIR1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces cerevisiae Mitochondrial Phosphate Carrier Protein (MIR1)

The Recombinant Saccharomyces cerevisiae Mitochondrial Phosphate Carrier Protein (MIR1) is a mitochondrial inner membrane protein encoded by the MIR1 gene (UniProt ID: P23641). It is a critical component of the mitochondrial carrier family (SLC25), responsible for transporting inorganic phosphate (Pi) into the mitochondrial matrix to support oxidative phosphorylation and ATP synthesis . Expressed in E. coli with an N-terminal His-tag, the recombinant protein spans the full-length sequence (1–311 amino acids) and retains functional activity for biochemical studies .

Biological Function and Substrate Specificity

MIR1 is essential for mitochondrial phosphate import, enabling ATP synthase to generate ATP during oxidative phosphorylation . Key findings include:

  • Substrate Preference: MIR1 transports phosphate (Pi) but not copper (Cu), unlike its mammalian homolog SLC25A3, which handles both .

  • Functional Redundancy: In S. cerevisiae, MIR1 and PIC2 (a paralog) share partial redundancy for phosphate transport, but MIR1 is more abundant and critical under normal conditions .

  • Phenotypic Impact: MIR1 deletion prevents growth on non-fermentable carbon sources (e.g., glycerol) and reduces mitochondrial protein levels .

Table 1: MIR1 vs. PIC2

FeatureMIR1PIC2
Primary SubstratePhosphate (Pi)Copper (Cu)
Gene DuplicationOriginated from an ancient duplication
EssentialityCritical for respirationDispensable under normal conditions
LocalizationMitochondrial inner membraneMitochondrial inner membrane
ActivitySupports phosphate-dependent mitochondrial swellingRequired for Cu uptake in L. lactis

Evolutionary Context and Functional Divergence

Phylogenetic analyses reveal that MIR1 and PIC2 arose from an ancient gene duplication event, with MIR1 specializing in phosphate transport and PIC2 in copper transport . This divergence is attributed to distinct substrate recognition mechanisms:

  • Phosphate Transport: Relies on hydrogen bonding and salt bridges (e.g., residues His33, Thr44, Lys90) .

  • Copper Transport: Requires transient covalent interactions, as seen in PIC2 .

Key Residues for Phosphate Transport

Residue (PIC2 numbering)Role in Phosphate TransportSource
Thr44 (Thr44 → Cys mutation reduces activity)Critical for phosphate binding
His33, Lys90Stabilizes phosphate via salt bridges

Biochemical Assays

  • Mitochondrial Swelling: MIR1-dependent phosphate uptake causes mitochondrial swelling in hypertonic phosphate buffer. The inhibitor ML316 blocks this process, confirming MIR1’s role .

  • Lactococcus lactis Model: MIR1, but not PIC2, transports arsenate (a phosphate mimic), while PIC2 transports Ag⁺ (a Cu mimic) .

Inhibitor ML316

PropertyDetail
TargetMIR1 (mitochondrial phosphate carrier)
EffectBlocks ATP production in Candida albicans, causing respiratory defects
Resistance MutationN184T in MIR1 (512-fold resistance in C. albicans)

Applications in Research and Therapeutics

  • Oxidative Phosphorylation Studies: MIR1 is used to study ATP synthase function and mitochondrial calcium handling .

  • Antifungal Development: ML316-inspired inhibitors target MIR1 in pathogenic fungi (e.g., Candida), offering a novel therapeutic strategy .

Future Directions

  1. Structural Elucidation: High-resolution crystallography to resolve MIR1’s conformational states during phosphate transport.

  2. Evolutionary Adaptations: Investigating why S. cerevisiae retained MIR1 over the non-functional paralog YER053C .

  3. Therapeutic Translation: Testing ML316 analogs in other fungal pathogens.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
MIR1; YJR077C; J1837; Mitochondrial phosphate carrier protein; Mitochondrial import receptor; Phosphate transport protein; PTP; mPic 1; p32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MIR1
Target Protein Sequence
MSVSAAPAIPQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSF KQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMG SAAMAEFLADIALCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQ IPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLS KVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLGC PPTIEIGGGGH
Uniprot No.

Target Background

Function
Facilitates the transport of phosphate groups from the cytosol to the mitochondrial matrix.
Database Links

KEGG: sce:YJR077C

STRING: 4932.YJR077C

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of MIR1 in Saccharomyces cerevisiae?

MIR1 serves as the primary transporter for inorganic phosphate into the mitochondrial matrix, which is essential for ATP synthesis. Genetic experiments have demonstrated that MIR1 is required for respiratory growth in S. cerevisiae, but interestingly, not for its fermentative growth . This selective requirement makes it particularly interesting for studying the transition between fermentative and respiratory metabolism.

The protein functions within the inner mitochondrial membrane, where it facilitates the exchange of phosphate for hydroxyl ions, maintaining phosphate homeostasis necessary for oxidative phosphorylation. Disruption of MIR1 function leads to impaired mitochondrial respiration and metabolic imbalances, including unusual accumulation of citrate in yeast cells .

How is recombinant MIR1 typically produced for research purposes?

Recombinant MIR1 protein is commonly produced using bacterial expression systems, particularly E. coli. The full-length gene sequence (encoding amino acids 1-311) is cloned into an appropriate expression vector with an N-terminal His-tag for purification purposes .

The expression process typically involves:

  • Transformation of the expression construct into competent E. coli cells

  • Induction of protein expression using IPTG or other inducers

  • Cell lysis and extraction of proteins

  • Purification using nickel affinity chromatography to isolate the His-tagged protein

  • Further purification steps as needed

  • Lyophilization to create a stable powder form

The final product is often provided as a lyophilized powder in a Tris/PBS-based buffer with trehalose (pH 8.0) to maintain stability. For experimental use, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C or -80°C .

What experimental approaches can be used to study the impact of MIR1 inhibition on fungal metabolism?

Studying MIR1 inhibition impacts requires a multi-faceted approach:

Metabolomic Analysis:

  • Employ LC-MS/MS to track metabolite changes following MIR1 inhibition

  • Monitor citrate accumulation, which has been identified as a key metabolic signature of MIR1 inhibition

  • Analyze flux through the TCA cycle using isotope-labeled substrates to identify metabolic bottlenecks

Oxygen Consumption Assessment:

  • Measure mitochondrial oxygen consumption rates using oxygen electrodes or plate-based respirometry

  • Compare respiration rates between normal and MIR1-inhibited conditions

  • Evaluate the differential impact on respiratory vs. fermentative growth conditions

Genetic Approaches:

  • Generate MIR1 knockout strains alongside chemical inhibition studies

  • Create partial loss-of-function mutants to model different levels of inhibition

  • Perform genetic suppressor screens to identify compensatory pathways

Structural Studies:

  • Utilize purified recombinant MIR1 protein for binding studies with potential inhibitors

  • Conduct protein crystallography to determine inhibitor binding sites

  • Perform in silico docking studies to predict new inhibitor candidates

A comprehensive approach combining these methodologies provides the most complete understanding of how MIR1 inhibition affects fungal cellular physiology and identifies potential therapeutic targets .

How does the function of MIR1 in S. cerevisiae compare to phosphate carriers in pathogenic fungi, and what are the implications for antifungal development?

The mitochondrial phosphate carrier shows evolutionary conservation across fungal species while maintaining sufficient differences from human orthologues to represent a potential therapeutic target. ML316, a thiohydantoin compound, has demonstrated the potential of targeting MIR1 for antifungal development:

CharacteristicS. cerevisiae MIR1Pathogenic Fungi PiCHuman PiCImplications
EssentialityRequired for respiration but not fermentationEssential for respiration in Candida speciesEssential for cellular functionSelective targeting possible during respiratory growth
Inhibitor sensitivitySensitive to ML316Nanomolar activity against Candida speciesLower sensitivityProvides therapeutic window
Metabolic responseCitrate accumulation upon inhibitionSimilar metabolic catastropheDifferent metabolic effectsBiomarker for target engagement
Drug resistanceNot associated with common resistance mechanismsCan enhance activity of azolesN/APotential combination therapy target

ML316 has demonstrated efficacy as a fungal-selective inhibitor of the mitochondrial phosphate carrier in drug-resistant Candida species at nanomolar concentrations. This inhibition results in diminished mitochondrial oxygen consumption and a unique metabolic catastrophe marked by citrate accumulation .

In mouse models of azole-resistant oropharyngeal candidiasis, MIR1 inhibition reduced fungal burden and enhanced azole activity, suggesting that targeting this protein could provide a valuable therapeutic strategy for addressing drug-resistant fungal infections .

What are the technical challenges in maintaining recombinant MIR1 protein stability and activity for functional assays?

Maintaining stability and functional activity of recombinant MIR1 presents several significant challenges:

Membrane Protein Solubility:

  • As a transmembrane protein, MIR1 requires careful buffer optimization to maintain proper folding

  • Detergent selection is critical for solubilization without denaturing the protein

  • Reconstitution into liposomes or nanodiscs may be necessary for activity assays

Oxidation Sensitivity:

  • Mitochondrial proteins often contain critical cysteine residues susceptible to oxidation

  • Reducing agents like DTT or β-mercaptoethanol should be included in buffers

  • Storage under nitrogen or argon atmosphere may help preserve activity

Freeze-Thaw Degradation:

  • Repeated freeze-thaw cycles significantly reduce protein activity

  • Working aliquots should be maintained at 4°C for up to one week

  • For long-term storage, adding 50% glycerol and storing at -80°C is recommended

Functional Reconstitution:

  • In vitro transport assays require reconstitution into artificial membranes

  • Phosphate transport activity is highly dependent on proper orientation in the membrane

  • Verification of function should include phosphate uptake assays using radioisotopes

To maximize stability and activity, the recombinant protein should be reconstituted in deionized sterile water to 0.1-1.0 mg/mL concentration, with glycerol added to a final concentration of 5-50%. Working aliquots should be maintained at 4°C, while long-term storage requires -20°C/-80°C conditions .

What expression systems and purification strategies yield the highest functional recovery of recombinant MIR1?

Optimization of expression and purification for MIR1 requires consideration of several key factors:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesYield of Functional MIR1
E. coliHigh expression levels, cost-effective, rapid growthLack of eukaryotic post-translational modifications, inclusion body formationModerate, requires refolding
Yeast (P. pastoris)Native environment for folding, glycosylation capabilityLonger expression time, more complex mediaHigh functional yield
Insect cellsAdvanced eukaryotic folding machineryHigher cost, complex methodologyVery high functional yield
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited scaleVariable, depends on membrane mimetics

Purification Strategy Optimization:

  • Affinity Chromatography: His-tag purification using nickel or cobalt resins (IMAC) provides highly specific initial capture

  • Size Exclusion Chromatography: Removes aggregates and improves homogeneity

  • Ion Exchange Chromatography: Further purifies based on charge properties

  • Detergent Exchange: Critical for maintaining native-like structure

For maximum recovery of functional protein, the E. coli expression system with an N-terminal His-tag has proven effective, particularly when cells are grown at lower temperatures (16-18°C) after induction to slow expression and promote proper folding . The purified protein is then best stored as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

What assays can be used to verify the functional activity of purified recombinant MIR1?

Several complementary assays can verify MIR1 functionality:

Phosphate Transport Assays:

  • Liposome reconstitution assay: MIR1 is incorporated into liposomes, and 32P-labeled phosphate uptake is measured

  • Proteoliposome counterflow assay: Pre-loaded proteoliposomes exchange internal phosphate for external radiolabeled phosphate

  • Membrane potential-dependent transport: Assesses phosphate transport under various membrane potentials

Binding Assays:

  • Isothermal titration calorimetry (ITC) to measure binding of phosphate and inhibitors

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Fluorescence-based assays using environment-sensitive probes

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to verify secondary structure

  • Limited proteolysis to assess proper folding

  • Thermal shift assays to determine protein stability

Inhibitor Responsiveness:

  • Oxygen consumption measurements in reconstituted systems with and without inhibitors like ML316

  • Monitoring metabolite changes (especially citrate accumulation) in response to MIR1 inhibition

  • Competitive binding assays with known substrates and inhibitors

A comprehensive functional assessment should include at least one transport assay and one structural integrity assay to confirm both the activity and proper folding of the recombinant protein.

How can researchers design effective experiments to study the role of MIR1 in mitochondrial metabolism and fungal pathogenicity?

Designing effective MIR1 research experiments requires strategic planning:

Genetic Manipulation Approaches:

  • CRISPR/Cas9 gene editing to create precise MIR1 mutations or knockouts

  • Inducible expression systems to control MIR1 levels temporally

  • Fluorescent protein tagging to monitor localization and expression levels

  • Heterologous expression of MIR1 variants to assess functional conservation

Metabolic Analysis Pipeline:

  • Stable isotope-resolved metabolomics to track phosphate incorporation into metabolites

  • Real-time monitoring of oxygen consumption rates under various conditions

  • ATP/ADP ratio measurements to assess energetic impact

  • Metabolic flux analysis to identify pathway rerouting upon MIR1 inhibition

Pathogenicity Assessment Framework:

  • In vitro growth assays comparing wild-type and MIR1-deficient strains under different carbon sources

  • Host-pathogen interaction models to assess virulence

  • Combination therapy testing with existing antifungals

  • In vivo infection models with MIR1 inhibition (chemical or genetic)

Key Control Conditions:

  • Comparing fermentative vs. respiratory growth conditions

  • Assessing effects in azole-resistant vs. sensitive strains

  • Testing in the presence of different phosphate concentrations

  • Including human cell controls for toxicity assessment

Integration of data from these approaches provides a comprehensive understanding of MIR1's role in fungal physiology and pathogenesis. The ML316 inhibitor has already demonstrated potential in combination therapy approaches, reducing fungal burden and enhancing azole activity in mouse models of oropharyngeal candidiasis .

How can recombinant MIR1 be utilized in screening platforms for novel antifungal compounds?

Recombinant MIR1 offers several strategic advantages for antifungal drug discovery:

High-Throughput Screening Platforms:

  • Fluorescence-based transport assays using purified MIR1 in liposomes

  • Thermal shift assays to identify compounds that stabilize or destabilize the protein

  • Competitive binding assays against known ligands like ML316

  • Fragment-based screening to identify novel chemical scaffolds

Secondary Validation Assays:

  • Oxygen consumption measurements in yeast mitochondria

  • Metabolomic profiling focusing on citrate accumulation as a biomarker

  • Growth inhibition assays comparing effects on respiratory vs. fermentative conditions

  • Synergy testing with established antifungals

Comparative Assessment Framework:

Screening ApproachAdvantagesThroughputHit Validation Strategy
Direct binding assaysTarget-specific, quantitativeHigh (10,000+ compounds/day)IC50 determination, structural studies
Functional transport assaysActivity-based, physiologically relevantMedium (1,000+ compounds/day)Dose-response in transport systems
Phenotypic respiration assaysIncorporates cellular contextLow-Medium (100+ compounds/day)MIR1 mutant rescue experiments
Metabolomic profilingIdentifies target engagementLow (10+ compounds/day)Citrate accumulation correlation

The development of ML316, a thiohydantoin that kills drug-resistant Candida species at nanomolar concentrations through fungal-selective inhibition of MIR1, demonstrates the potential of this approach. This compound diminished mitochondrial oxygen consumption in respiring yeast, resulting in a metabolic catastrophe marked by citrate accumulation .

What research questions remain unresolved regarding the structure-function relationship of MIR1?

Despite significant progress, several critical knowledge gaps remain:

Structural Dynamics:

  • High-resolution crystal structure of MIR1 has not been determined

  • Conformational changes during transport cycle remain poorly understood

  • Substrate recognition mechanisms and specificity determinants need clarification

  • Role of specific amino acid residues in transport function requires further characterization

Regulatory Mechanisms:

  • Post-translational modifications affecting MIR1 activity

  • Interactions with other mitochondrial proteins in transport complexes

  • Transcriptional and translational regulation under different metabolic conditions

  • Turnover and degradation pathways controlling MIR1 levels

Comparative Biology:

  • Functional differences between MIR1 in S. cerevisiae and pathogenic fungi

  • Evolutionary adaptations in phosphate transport across fungal species

  • Species-specific inhibitor selectivity determinants

  • Compensatory mechanisms in response to MIR1 inhibition

Therapeutic Potential:

  • Optimization of ML316 and derivative compounds for improved pharmacokinetics

  • Resistance mechanisms that may emerge against MIR1 inhibitors

  • Potential off-target effects on human phosphate carriers

  • Synergistic combinations with existing antifungal classes

Addressing these questions will require integrated approaches combining structural biology, biochemistry, genetics, and pharmacology. The development of ML316 as the first identified Mir1 inhibitor has opened new avenues for research into this promising antifungal target .

What are the optimal storage and handling conditions for maintaining recombinant MIR1 stability?

Proper handling of recombinant MIR1 is critical for experimental reproducibility:

Storage Recommendations:

  • Short-term storage (up to one week): 4°C as working aliquots

  • Medium-term storage: -20°C with 50% glycerol

  • Long-term storage: -80°C or as lyophilized powder

  • Avoid repeated freeze-thaw cycles which significantly reduce activity

Buffer Composition:

  • Tris/PBS-based buffer at pH 8.0

  • Addition of 6% trehalose as a stabilizing agent

  • 50% glycerol for frozen storage

  • Consider adding reducing agents to prevent oxidation of sulfhydryl groups

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration

  • Aliquot for long-term storage to avoid repeated freeze-thaw cycles

Quality Control Indicators:

  • Purity should be >90% as determined by SDS-PAGE

  • Functional activity should be verified after extended storage

  • Appearance should be clear without visible precipitation

  • Occasional gentle mixing rather than vortexing is recommended

Following these guidelines will help maintain protein integrity and experimental consistency across studies using recombinant MIR1 protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.