Recombinant Saccharomyces cerevisiae Mitochondrial respiratory chain complexes assembly protein AFG3 (AFG3)

Shipped with Ice Packs
In Stock

Description

Protein Composition and Sequence

AFG3 is a full-length protein comprising 761 amino acids that functions as a component of a mitochondrial inner membrane AAA protease . The recombinant form typically includes an N-terminal His tag for purification purposes and is expressed in E. coli expression systems . The complete amino acid sequence of AFG3 has been determined and features several functional domains characteristic of AAA proteases, including ATP-binding regions and proteolytic domains essential for its function. The amino acid sequence reveals multiple structural motifs that facilitate its integration into the mitochondrial inner membrane and its interaction with substrate proteins within the organelle .

Table 1: Key Properties of Recombinant AFG3 Protein

CharacteristicDescription
SpeciesSaccharomyces cerevisiae
Length761 amino acids (full length)
Expression SystemE. coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ApplicationsSDS-PAGE, enzymatic assays, protein interaction studies

Physical and Biochemical Properties

Recombinant AFG3 protein exhibits specific biochemical properties that influence its handling and application in research settings. The protein is typically prepared as a lyophilized powder and requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use . For optimal stability, the addition of 5-50% glycerol is recommended, and the reconstituted protein should be stored at -20°C/-80°C with aliquoting advised to prevent repeated freeze-thaw cycles that might compromise protein integrity . Working aliquots can be maintained at 4°C for up to one week without significant loss of activity .

Proteostasis and Quality Control

AFG3 serves a critical function in maintaining mitochondrial proteostasis—the balanced state of protein synthesis, folding, and degradation within mitochondria . As an ATP-dependent protease, AFG3 identifies and degrades misfolded or damaged proteins, preventing their accumulation which could otherwise compromise mitochondrial function . This quality control mechanism ensures the integrity of the mitochondrial proteome under both normal physiological conditions and during cellular stress .

Assembly of Respiratory Chain Complexes

One of the primary functions of AFG3 is facilitating the proper assembly of electron transport chain complexes in the mitochondrial inner membrane . These complexes are crucial components of the oxidative phosphorylation system responsible for ATP production. The importance of AFG3 in this process is evidenced by the inability of AFG3-deleted yeast strains to grow on non-fermentable carbon sources, which require functional mitochondrial respiration . This respiratory deficiency highlights AFG3's essential role in maintaining energy metabolism in yeast cells.

Mitochondrial Ribosome Assembly

Research has identified a specific substrate of AFG3's proteolytic activity: the mitochondrial ribosomal protein Mrpl32 . AFG3-mediated cleavage of Mrpl32 is required for the proper assembly of mitochondrial ribosome particles . This function establishes a direct link between AFG3 activity and mitochondrial translation, suggesting that AFG3 contributes to coordinating protein synthesis and degradation within the mitochondrial compartment. This coordination is essential for maintaining the appropriate balance of mitochondrial proteins and ensuring optimal organelle function .

AFG3 Deletion Phenotypes

Deletion of the AFG3 gene in Saccharomyces cerevisiae results in several distinct phenotypes that reveal the protein's broad influence on cellular functions:

  1. Respiratory deficiency: AFG3-deleted (afg3Δ) yeast cells cannot grow on non-fermentable carbon sources like glycerol, indicating impaired mitochondrial respiration .

  2. Reduced cytoplasmic mRNA translation: Surprisingly, afg3Δ cells exhibit significantly decreased cytoplasmic protein synthesis, suggesting cross-talk between mitochondrial and cytoplasmic translation processes .

  3. Increased stress resistance: AFG3-deleted cells show enhanced resistance to tunicamycin, an agent that induces endoplasmic reticulum stress. This resistance is particularly evident at higher concentrations of tunicamycin (2.5 μg/mL), where afg3Δ cells demonstrate faster doubling times (156 min) compared to wild-type cells (284 min), despite being slow-growing under normal conditions .

  4. Extended lifespan: afg3Δ cells demonstrate increased replicative lifespan compared to wild-type cells, identifying AFG3 as a longevity-related gene in yeast .

These phenotypic effects indicate that AFG3 influences cellular processes beyond its direct role in mitochondrial proteostasis and respiratory chain assembly, suggesting broader regulatory functions in cellular homeostasis .

Lifespan Extension Mechanisms

The observation that AFG3 deletion extends replicative lifespan in yeast has prompted investigations into the underlying mechanisms. Studies have demonstrated that this lifespan extension shares characteristics with other longevity pathways:

  1. It is independent of the endoplasmic reticulum unfolded protein response transcription factor Hac1 .

  2. The extension does not require the histone deacetylase Sir2, which mediates lifespan extension in some other longevity pathways .

  3. The lifespan extension depends on the transcription factor Gcn4, which is involved in the cellular response to nutrient limitation .

These findings suggest that AFG3 modulates longevity through a mechanism similar to that of cytoplasmic ribosomal large subunit proteins, potentially involving the regulation of protein synthesis and stress response pathways .

Cross-talk Between Mitochondria and Cytoplasm

The unexpected effect of AFG3 deletion on cytoplasmic translation suggests a previously unrecognized role for this mitochondrial protein in regulating cellular processes beyond the mitochondria . Although AFG3 functions primarily within mitochondria, its absence appears to trigger signaling events that affect cytoplasmic protein synthesis. One proposed model suggests that failure to properly assemble mitochondrial ribosomes or other mitochondrial complexes in the absence of AFG3 induces a retrograde signal from mitochondria to the cytoplasm, inhibiting cytoplasmic mRNA translation . This response may serve to prevent imbalances between nuclear-encoded and mitochondrially-encoded proteins under conditions where mitochondrial translation is impaired .

Expression and Purification Methods

Recombinant AFG3 protein is typically produced using Escherichia coli expression systems, with the full-length Saccharomyces cerevisiae AFG3 protein (amino acids 1-761) fused to an N-terminal His tag . This approach facilitates purification through affinity chromatography and yields protein suitable for various research applications. The recombinant protein is typically purified to greater than 90% homogeneity as determined by SDS-PAGE analysis .

Research Applications

Recombinant AFG3 protein serves various research purposes, particularly in studies investigating:

  1. Mitochondrial protein quality control mechanisms

  2. Assembly pathways of respiratory chain complexes

  3. Mitochondrial ribosome biogenesis

  4. Signaling between mitochondria and the cytoplasm

  5. Cellular aging processes and stress responses

The availability of purified recombinant AFG3 enables detailed biochemical and functional analyses that contribute to our understanding of these essential cellular processes .

Complementation Studies

Recombinant AFG3 can be used in complementation studies to investigate functional conservation across species. Such studies have revealed that certain human proteins can functionally substitute for yeast AFG3 in specific contexts, highlighting evolutionary conservation of protein function . For example, studies examining N-terminal acetylation pathways have shown that human enzymes like NatF/Naa60 can rescue certain defects in yeast cells lacking active NatC complex components . These findings demonstrate the utility of yeast as a model system for studying conserved protein functions and interactions.

Genetic Suppressors of AFG3 Deletion

Genetic studies have identified several genes that, when overexpressed, can partially suppress the respiratory deficiency caused by AFG3 deletion . These suppressors include:

  1. PIM1(LON): Encodes a matrix-localized ATP-dependent protease involved in the turnover of matrix proteins .

  2. OXA1(PET1402): Encodes a putative mitochondrial inner membrane protein involved in the biogenesis of the respiratory chain .

  3. MBA1: Encodes a mitochondrial protein required for optimal respiratory growth .

Notably, these suppressors also rescue the phenotypes associated with deletion of RCA1, another gene encoding a related mitochondrial protease, suggesting functional overlap or parallel pathways . All three suppressor genes affect the biogenesis of respiratory-competent mitochondria, highlighting the interconnected nature of mitochondrial quality control mechanisms .

Role in Mitochondrial Translation

The relationship between AFG3 and mitochondrial translation is complex and bidirectional. AFG3 contributes to mitochondrial translation through its role in processing the ribosomal protein Mrpl32, which is required for mitochondrial ribosome assembly . Conversely, the absence of AFG3 affects cytoplasmic translation, suggesting cross-talk between these two protein synthesis systems . This interconnection likely serves as a mechanism to coordinate nuclear and mitochondrial gene expression, ensuring appropriate stoichiometry of protein complexes composed of subunits encoded by both genomes .

Table 2: Suppressors of AFG3 Deletion

GeneProtein FunctionEffect on afg3Δ Phenotype
PIM1(LON)Matrix-localized ATP-dependent proteasePartial restoration of growth on non-fermentable carbon sources
OXA1(PET1402)Mitochondrial inner membrane protein involved in respiratory chain biogenesisPartial restoration of growth on non-fermentable carbon sources
MBA1Mitochondrial protein required for optimal respiratory growthPartial restoration of growth on non-fermentable carbon sources

Connections to Cellular Stress Responses

The enhanced resistance to tunicamycin observed in afg3Δ cells suggests a connection between AFG3 function and cellular stress response pathways . This resistance appears to be independent of the canonical endoplasmic reticulum unfolded protein response mediated by the transcription factor Hac1, indicating the involvement of alternative stress response mechanisms . The dependence on the transcription factor Gcn4 for both lifespan extension and stress resistance in afg3Δ cells points to potential links with nutrient sensing and protein synthesis regulation pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
AFG3; YTA10; YER017C; Mitochondrial respiratory chain complexes assembly protein AFG3; ATPase family gene 3 protein; Tat-binding homolog 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-761
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
AFG3
Target Protein Sequence
MMMWQRYARGAPRSLTSLSFGKASRISTVKPVLRSRMPVHQRLQTLSGLATRNTIHRSTQ IRSFHISWTRLNENRPNKEGEGKNNGNKDNNSNKEDGKDKRNEFGSLSEYFRSKEFANTM FLTIGFTIIFTLLTPSSNNSGDDSNRVLTFQDFKTKYLEKGLVSKIYVVNKFLVEAELVN TKQVVSFTIGSVDIFEEQMDQIQDLLNIPPRDRIPIKYIERSSPFTFLFPFLPTIILLGG LYFITRKINSSPPNANGGGGGGLGGMFNVGKSRAKLFNKETDIKISFKNVAGCDEAKQEI MEFVHFLKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAGEANVPFLSVSGSEFVEM FVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALGGANDEREATLNQLLVEM DGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVNGRQQIYLVHLKRLNLDP LLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPYITIHHFEQAIERVIAGL EKKTRVLSKEEKRSVAYHEAGHAVCGWFLKYADPLLKVSIIPRGQGALGYAQYLPPDQYL ISEEQFRHRMIMALGGRVSEELHFPSVTSGAHDDFKKVTQMANAMVTSLGMSPKIGYLSF DQNDGNFKVNKPFSNKTARTIDLEVKSIVDDAHRACTELLTKNLDKVDLVAKELLRKEAI TREDMIRLLGPRPFKERNEAFEKYLDPKSNTEPPEAPAATN
Uniprot No.

Target Background

Function
AFG3 acts as a component of the m-AAA protease complex, an ATP-dependent metalloprotease responsible for degrading non-assembled mitochondrial inner membrane proteins. This complex is essential for the assembly of mitochondrial respiratory chain and ATPase complexes. It plays a role in both post-translational assembly and the turnover of mistranslated or misfolded polypeptides.
Gene References Into Functions
  1. Replacement of the Yta10 TM2 domain disrupts membrane dislocation for only a subset of substrates, while replacement of the Yta12 TM2 domain impairs membrane dislocation for all tested substrates. This suggests distinct roles for the TM domains within each m-AAA protease subunit. PMID: 29030426
  2. Observations demonstrate a role for the mitochondrial protease Afg3 in modulating cytoplasmic mRNA translation and ER stress resistance. Furthermore, it suggests that Afg3 modulates longevity in yeast through a mechanism similar to cytoplasmic ribosomal large subunit proteins. PMID: 23167605
Database Links

KEGG: sce:YER017C

STRING: 4932.YER017C

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of AFG3 protein?

AFG3 is a 761-amino acid protein that contains multiple functional domains characteristic of AAA-family ATPases . The protein features an N-terminal region that anchors it to the mitochondrial inner membrane, followed by an ATPase domain responsible for energy-dependent functions, and a metalloprotease domain that executes its proteolytic activities. The full amino acid sequence includes specific motifs essential for ATP binding and hydrolysis (Walker A and B motifs) in the ATPase domain . The protein's catalytic sites are oriented toward the mitochondrial matrix, allowing it to access and degrade misfolded proteins in this compartment. Structural studies suggest that functional AFG3 assembles into oligomeric complexes that form a central pore through which substrate proteins are threaded during the degradation process.

How does AFG3 relate to mitochondrial function in yeast?

AFG3 plays a crucial role in maintaining mitochondrial integrity and function in Saccharomyces cerevisiae. By facilitating the degradation of misfolded or damaged proteins, AFG3 prevents the accumulation of potentially toxic protein aggregates within the mitochondria . Additionally, AFG3 is directly involved in the assembly of respiratory chain complexes, which are essential for oxidative phosphorylation and cellular energy production. Disruption of AFG3 function leads to impaired respiratory capacity, particularly evident when yeast cells are grown on non-fermentable carbon sources that require functional mitochondria for energy generation. The protein also contributes to maintaining mitochondrial DNA stability and participates in stress response pathways that protect mitochondria during various cellular challenges.

How does AFG3 distinguish between properly folded and misfolded proteins?

AFG3's substrate discrimination mechanism involves recognizing specific structural features that become exposed in misfolded proteins. Current research suggests that AFG3, as part of the m-AAA protease complex, recognizes exposed hydrophobic patches and abnormal structural elements that are typically buried in correctly folded proteins . This recognition process likely involves direct binding of aberrant structural features to specific substrate-binding regions within AFG3's structure. The protein may also recognize specific degrons (degradation signals) that become accessible in misfolded proteins. Research methods to investigate this selectivity include site-directed mutagenesis to create model substrates with defined folding defects, proximity labeling to identify interacting partners, and structural studies to visualize substrate-enzyme interactions.

What is the ATP-dependent mechanism by which AFG3 mediates protein degradation?

AFG3 utilizes ATP hydrolysis to drive the process of substrate protein degradation through a coordinated series of conformational changes. As a member of the AAA+ protein family, AFG3 harnesses the energy from ATP binding and hydrolysis to undergo structural rearrangements that facilitate substrate processing . The current model suggests that ATP binding induces conformational changes that create a substrate-binding pocket, while ATP hydrolysis generates mechanical force to unfold and translocate the substrate protein through the central pore of the AFG3 complex. This unfolding exposes peptide bonds that can then be cleaved by the metalloprotease domain. The process is processive, with multiple cycles of ATP hydrolysis driving the complete degradation of the substrate protein. This mechanism allows AFG3 to tackle even stably folded proteins that would otherwise resist proteolytic degradation.

What are the optimal expression systems for producing recombinant AFG3?

For successful expression of recombinant AFG3, Escherichia coli systems with appropriate affinity tags have proven effective, as demonstrated by the commercially available His-tagged full-length AFG3 protein . When designing expression constructs, researchers should consider including a purification tag (such as His6 or GST) that can be cleaved after purification if necessary for functional studies. Expression should be performed under controlled conditions with moderate induction to prevent inclusion body formation. Alternative expression systems worth considering include yeast expression systems (particularly S. cerevisiae itself) for proper post-translational modifications, or cell-free expression systems for challenging membrane proteins. For structural studies requiring high yields, insect cell expression systems may provide advantages. Each system requires optimization of codon usage, induction conditions, temperature, and media composition to maximize the yield of properly folded, functional protein.

How can researchers effectively purify functional AFG3 protein while maintaining its native conformation?

Purifying functional AFG3 while preserving its native conformation requires careful consideration of its membrane protein characteristics. A successful purification protocol typically begins with optimized expression in E. coli with appropriate tags such as the His-tag . The purification process should include gentle cell lysis using mild detergents that can solubilize membrane proteins without denaturing them, such as n-dodecyl-β-D-maltoside (DDM) or digitonin. Following initial capture on affinity resins (such as Ni-NTA for His-tagged AFG3), size exclusion chromatography helps separate properly folded protein from aggregates. Throughout the purification process, maintaining appropriate buffer conditions is critical, with recommendations for storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Addition of ATP or non-hydrolyzable ATP analogs during purification can help stabilize the native conformation of this AAA-family ATPase. Multiple quality control steps should be implemented to verify protein integrity.

What assays are most effective for measuring AFG3 proteolytic activity in vitro?

Several complementary assays can effectively measure AFG3 proteolytic activity in vitro, each with specific advantages. FRET-based peptide cleavage assays using synthetic peptides with fluorophore-quencher pairs provide real-time kinetic data on proteolytic activity. These assays allow for rapid screening of conditions or inhibitors but use artificial substrates. For more physiologically relevant assessment, researchers can develop assays using purified native substrate proteins labeled with fluorescent tags or radioisotopes, tracking their degradation over time. ATP hydrolysis assays measuring inorganic phosphate release serve as indirect measures of AFG3 activity and provide insights into the coupling between ATP hydrolysis and proteolysis. Reconstitution of AFG3 into liposomes or nanodiscs can allow for membrane-based activity assays that better mimic the native environment. Critical controls should include catalytically inactive AFG3 mutants, ATP-depleted conditions, and specific metalloprotease inhibitors to confirm specificity.

How can researchers overcome solubility issues when working with recombinant AFG3?

Addressing solubility challenges with recombinant AFG3 requires multiple strategic approaches. First, optimize the expression construct by considering fusion partners known to enhance solubility, such as MBP (maltose-binding protein), SUMO, or thioredoxin, while maintaining the necessary His-tag for purification . Second, expression conditions should be carefully controlled—lower temperatures (16-20°C), reduced inducer concentrations, and specialized media formulations can significantly improve the proportion of soluble protein. Third, during extraction and purification, use optimized detergent mixtures appropriate for membrane proteins, testing different detergent types and concentrations to identify conditions that efficiently solubilize AFG3 without denaturation. Fourth, incorporate stabilizing agents such as glycerol, specific lipids, or the trehalose mentioned in storage recommendations throughout the purification process. Fifth, consider co-expression with natural binding partners or chaperones that might facilitate proper folding. Finally, if traditional approaches fail, directed evolution or rational design of solubility-enhanced AFG3 variants may provide alternatives for specific experimental applications.

How can researchers differentiate between direct and indirect effects of AFG3 manipulation?

Differentiating between direct and indirect effects of AFG3 manipulation requires careful experimental design and multiple complementary approaches. First, researchers should create catalytically inactive mutants (e.g., mutations in the metalloprotease active site) that maintain structure but lack proteolytic activity, allowing separation of structural from enzymatic functions. Second, acute depletion systems (such as auxin-inducible or temperature-sensitive degrons) help distinguish immediate from adaptive effects of AFG3 loss. Third, substrate trapping approaches using AFG3 variants that can bind but not process substrates can identify direct interaction partners. Fourth, in vitro reconstitution experiments with purified components provide definitive evidence for direct effects. Fifth, time-course analyses following AFG3 perturbation can reveal the sequence of events, with primary (direct) effects occurring before secondary consequences. Sixth, epistasis analyses with known AFG3 substrates or interacting partners can clarify pathway relationships. Finally, complementation experiments restoring wild-type or mutant versions of AFG3 help establish which phenotypes are directly attributable to specific AFG3 functions.

How can contradictory results about AFG3 function be reconciled across different experimental conditions?

Reconciling contradictory results about AFG3 function requires systematic analysis of experimental variables and biological context. First, researchers should carefully examine differences in genetic backgrounds between studies, as suppressor mutations or variations in other mitochondrial quality control components might influence AFG3-dependent phenotypes . Second, growth conditions significantly impact mitochondrial function—differences in carbon sources (fermentable versus non-fermentable), oxygen availability, and growth phase can lead to seemingly contradictory observations. Third, the methodological approaches used to assess AFG3 function may have different sensitivities; for example, acute depletion may reveal different phenotypes compared to germline knockout models due to compensatory adaptations in the latter. Fourth, the specific assays used to measure mitochondrial function (respiration measurements, membrane potential assessment, or protein turnover rates) may capture different aspects of AFG3's multifaceted roles. To address these contradictions systematically, researchers should design comparative studies that explicitly test AFG3 function across standardized conditions, performing multiple complementary assays in parallel.

How is AFG3 research in yeast contributing to understanding human mitochondrial disorders?

Research on AFG3 in Saccharomyces cerevisiae provides valuable insights into human mitochondrial disorders through comparative biology approaches. The RAD52 epistasis group of genes, which includes systems related to mitochondrial function, has been highly conserved among eukaryotes . AFG3 is homologous to human AFG3L2, mutations in which cause several neurodegenerative disorders. The conserved functions of these proteins in mitochondrial quality control and respiratory complex assembly make yeast an excellent model system for studying disease mechanisms . Studies in yeast have elucidated the biochemical consequences of disease-associated mutations by introducing equivalent changes into AFG3 and analyzing their effects on protein function, mitochondrial morphology, and respiratory capacity. High-throughput screening in yeast models has identified potential genetic modifiers and chemical compounds that can suppress defects caused by AFG3 dysfunction, providing candidate therapeutic targets for human disorders. The tractability of yeast for genetic manipulation allows researchers to rapidly test hypotheses about disease mechanisms before validation in more complex mammalian systems.

What role does AFG3 play in cellular aging and stress response pathways?

AFG3 plays critical roles in cellular aging and stress response pathways through its functions in mitochondrial protein quality control. As yeast cells age, there is an increased burden of misfolded and damaged proteins within mitochondria, making AFG3's proteolytic activity increasingly important for maintaining mitochondrial function . Research has shown that AFG3 dysfunction accelerates the aging process in yeast, leading to premature loss of respiratory capacity and increased production of reactive oxygen species. Under stress conditions such as heat shock or oxidative stress, AFG3 activity is modulated to cope with increased protein damage, suggesting its integration into broader cellular stress response networks. The protein also contributes to the mitochondrial unfolded protein response (UPRmt), a conserved adaptive pathway that responds to mitochondrial protein folding stress. Understanding how AFG3 function changes during aging or under stress conditions provides insights into fundamental aspects of cellular homeostasis and may identify intervention points to promote cellular health and longevity.

How can advanced structural biology techniques enhance our understanding of AFG3 function?

Advanced structural biology techniques offer powerful approaches to deepen our understanding of AFG3 structure-function relationships. Cryo-electron microscopy (cryo-EM) can reveal the three-dimensional organization of AFG3 complexes in different functional states (e.g., ATP-bound, during substrate processing), providing mechanistic insights that were previously inaccessible. X-ray crystallography of individual domains or subcomplexes complements cryo-EM by providing higher-resolution details of critical functional regions. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes in AFG3 during substrate binding and processing, revealing dynamic aspects of its mechanism. Crosslinking mass spectrometry (XL-MS) identifies interaction surfaces between AFG3 subunits and with substrate proteins. Advanced NMR techniques applicable to large membrane protein complexes, such as methyl-TROSY, can provide information about specific dynamics relevant to function. Integrating these structural approaches with functional assays and computational modeling creates a comprehensive understanding of how AFG3 structure dictates its various functions in mitochondrial proteostasis and respiratory chain assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.