Recombinant Saccharomyces cerevisiae Mitochondrial RNA-splicing protein MRS3 (MRS3)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Saccharomyces cerevisiae Mitochondrial RNA-splicing protein MRS3 (MRS3) is a 314-amino-acid protein encoded by the MRS3 gene (UniProt ID: P10566). It belongs to the mitochondrial carrier family (MCF) and plays dual roles in mitochondrial iron transport and RNA splicing . The recombinant form, expressed in E. coli with an N-terminal His tag, is widely used to study its biochemical properties and functional mechanisms .

Functional Roles in Mitochondrial Iron and Copper Homeostasis

MRS3 is critical for mitochondrial iron metabolism and interacts with copper transport systems:

Iron Transport

  • Primary Role: Mediates mitochondrial iron uptake, essential for Fe/S cluster and heme biosynthesis .

  • Synergy with MRS4: Mrs3 and Mrs4 are functionally redundant; double deletion (mrs3Δmrs4Δ) causes iron deficiency phenotypes, including reduced heme synthesis and Fe/S protein activity .

  • Iron Homeostasis: ΔΔ mutants accumulate excess iron under iron-sufficient conditions, indicating dysregulated iron storage .

Copper Transport Overlap

  • Interaction with Pic2: MRS3 partially compensates for the copper transporter Pic2; overexpression suppresses copper uptake defects in pic2Δ strains .

  • Dual Substrate Capacity: Heterologous expression in Lactococcus lactis confirms MRS3 can transport both iron and copper .

Iron-Dependent Phenotypes

  • ΔΔ strains exhibit slow growth in iron-deficient media but recover in iron-rich conditions .

  • Mitochondria from ΔΔ cells show impaired Fe/S cluster assembly and elevated labile iron pools .

Oxidative Stress Sensitivity

  • Cryptococcus neoformans homologs of MRS3/4 are required for oxidative stress resistance, linking iron metabolism to pathogenicity .

Transcriptional Regulation

  • MRS3/4 deletion or overexpression upregulates the iron regulon, including plasma membrane iron transporters .

Biochemical and Biophysical Characteristics

  • Spectroscopic Analysis: Mössbauer and EPR studies reveal labile iron pools in ΔΔ mitochondria dominated by nonheme high-spin Fe(II)/Fe(III)-species .

  • Purity and Stability: >90% purity with glycerol (50%) recommended for long-term storage .

Interactions with RNA and Proteins

MRS3 exhibits predicted RNA-binding activity, with interactions involving:

RNA/ProteinInteraction ScoreFunction
NSR116.43 (z-score: 0.22)Ribosomal RNA processing
NOP115.66 (z-score: 0.10)rRNA methylation and ribosome biogenesis

Applications in Research

  • Iron Metabolism Studies: Used to dissect mitochondrial iron transport mechanisms .

  • Pathogen Research: Homologs in C. neoformans inform antifungal drug targeting .

  • Biochemical Assays: SDS-PAGE analysis for protein purity and stability .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MRS3; YJL133W; J0675; Mitochondrial RNA-splicing protein MRS3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MRS3
Target Protein Sequence
MVENSSSNNSTRPIPAIPMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTR IQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLI DSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQIYQSEGLA AFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAITTPL DCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAIS WTAYECAKHFLMTY
Uniprot No.

Target Background

Function
MRS3 suppresses a mitochondrial splice defect in the first intron of the COB gene. It may act as a carrier, exerting its suppressor activity through modulation of solute concentrations within the mitochondrion (potentially of cations).
Gene References Into Functions
  1. Three highly conserved histidine residues are crucial for Mrs3p function and mitochondrial iron transport. Mrs (mitochondrial RNA splicing (Mrs)3p and Mrs4p are inserted into liposomes. PMID: 24624902
  2. Inner mitochondrial membrane vesicles (SMPs) from the double deletion strain mrs3/4Delta failed to demonstrate rapid Fe(2+) uptake, while SMPs from cells overproducing Mrs3/4p exhibited increased Fe(2+) uptake rates. PMID: 19285482
Database Links

KEGG: sce:YJL133W

STRING: 4932.YJL133W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does the dual functionality of MRS3 in iron and copper transport impact mitochondrial processes?

The dual functionality of MRS3 in transporting both iron and copper is critical for proper mitochondrial function, particularly for the assembly and activity of respiratory complexes. Iron is essential for iron-sulfur cluster formation and heme synthesis, while copper is required for cytochrome c oxidase activity. When MRS3 function is compromised, both copper-dependent and iron-dependent processes can be affected, leading to respiratory deficiencies. This is evidenced by the copper-dependent growth defect observed on non-fermentable carbon sources when MRS3 is deleted, indicating impaired respiratory function .

What is the relationship between MRS3 and other mitochondrial carrier proteins?

MRS3 functions in parallel with other mitochondrial carrier proteins, particularly PIC2, which has been identified as a dedicated mitochondrial copper importer. Research has shown that deletion of both PIC2 and MRS3 leads to a more severe respiratory growth defect than either individual mutant, suggesting partially overlapping but distinct functions. Additionally, overexpression of MRS3 from a high copy number vector can suppress the oxygen consumption and copper uptake defects in a strain lacking PIC2, further supporting functional overlap between these transport systems .

What gene deletion strategies are most effective for studying MRS3 function?

For studying MRS3 function, researchers typically employ single gene deletion (Δmrs3) as well as combination deletions with functionally related genes (e.g., Δmrs3Δpic2). The most effective approach involves:

  • Creating precise deletion mutants using homologous recombination techniques

  • Verifying deletions using PCR and sequencing

  • Complementing deletions with plasmid-expressed wild-type or mutant MRS3 to confirm phenotype specificity

  • Testing growth on different carbon sources (fermentable vs. non-fermentable) to assess respiratory function

This methodology allows researchers to distinguish between the iron and copper transport functions of MRS3 by observing phenotypes under different metal availability conditions and comparing with other transporter mutants .

What expression systems are suitable for producing recombinant MRS3 for biochemical studies?

Several expression systems have proven effective for producing recombinant MRS3:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, rapid growthPotential improper folding of eukaryotic membrane proteinsInitial structural studies, antibody production
Lactococcus lactisDemonstrated success with MRS3 functional expressionLower yield than E. coliFunctional transport assays
S. cerevisiaeNative environment, proper folding and modificationsModerate yieldComplementation studies, functional assays
Pichia pastorisHigh yield of properly folded membrane proteinsMore complex than E. coliLarge-scale purification for structural studies

Lactococcus lactis has been specifically documented as a successful system for functional expression of MRS3, allowing demonstration of both copper and iron transport activities .

How can researchers effectively measure MRS3-mediated metal transport in isolated mitochondria?

Measuring MRS3-mediated metal transport in isolated mitochondria requires careful experimental design:

  • Isolate intact mitochondria from wild-type and Δmrs3 yeast strains using differential centrifugation techniques

  • Assess membrane integrity using standard assays (e.g., cytochrome c accessibility)

  • Measure metal uptake using either:

    • Radioactive isotopes (64Cu, 55Fe) for direct measurement of transport kinetics

    • Metal-sensitive fluorescent probes for real-time monitoring

    • ICP-MS (Inductively Coupled Plasma Mass Spectrometry) for precise quantification of metal content

  • Include appropriate controls:

    • Uncouplers to eliminate membrane potential effects

    • Competing metals to assess specificity

    • Known transport inhibitors

This approach allows for quantitative assessment of transport rates and substrate specificities, essential for understanding the biochemical properties of MRS3 .

How do post-translational modifications regulate MRS3 transport activity?

While specific post-translational modifications (PTMs) of MRS3 are not extensively described in the provided search results, researchers investigating this question should consider:

  • Phosphorylation: Examine potential regulatory phosphorylation sites using mass spectrometry-based phosphoproteomics

  • Ubiquitination: Assess protein stability and turnover under different metal stress conditions

  • Redox modifications: Investigate how oxidative stress might affect MRS3 through cysteine modifications

These PTMs likely respond to cellular metal status and metabolic conditions. For example, in yeast global response studies, proteins involved in metabolic pathways show distinct PTM patterns following environmental stresses. Similar regulatory mechanisms may apply to MRS3, potentially affecting its selectivity between iron and copper transport or its activity levels in response to cellular needs .

What is the structural basis for the dual metal specificity of MRS3?

The structural basis for MRS3's ability to transport both iron and copper likely involves:

  • Metal coordination sites with amino acid residues capable of binding both Fe2+/3+ and Cu1+/2+

  • Conformational changes that accommodate different ionic radii and coordination geometries

  • Potential allosteric regulation by other molecules or proteins

Researchers should approach this question through:

  • Site-directed mutagenesis of predicted metal-binding residues

  • Structural studies using X-ray crystallography or cryo-EM

  • Molecular dynamics simulations to model metal binding and transport pathways

  • Comparison with structurally characterized members of the mitochondrial carrier family

The heterologous expression in Lactococcus lactis has confirmed that MRS3 can mediate both copper and iron transport, providing a valuable system for structure-function studies .

How does MRS3 functionally interact with the mitochondrial copper chaperone network?

MRS3's role in copper transport suggests interaction with the mitochondrial copper chaperone network. Research approaches should include:

  • Identifying physical interactions between MRS3 and copper chaperones using techniques such as:

    • Co-immunoprecipitation

    • Proximity labeling methods (BioID, APEX)

    • Yeast two-hybrid or split-ubiquitin assays for membrane proteins

  • Functional interaction studies:

    • Genetic interaction analysis (synthetic lethality/sickness screens)

    • Copper-dependent enzyme activity assays in various genetic backgrounds

    • In vivo copper tracking using fluorescent sensors

The finding that a PIC2 and MRS3 double mutant prevented copper-dependent activation of a heterologously expressed copper sensor in the mitochondrial intermembrane space provides evidence that MRS3 contributes to copper availability in this compartment, suggesting potential interactions with copper chaperones that function there .

What are common pitfalls in phenotypic analysis of MRS3 mutant strains?

Researchers working with MRS3 mutants should be aware of several common pitfalls:

  • Redundancy issues: Due to functional overlap with other transporters like PIC2, single Δmrs3 mutants may show subtle phenotypes that are difficult to detect without optimized conditions

  • Media composition effects:

    • Trace metal contamination in media components can mask phenotypes

    • Carbon source selection is critical (use non-fermentable carbon to reveal respiratory defects)

  • Strain background variations: Different S. cerevisiae laboratory strains may show varying degrees of phenotypic expression

  • Environmental variables:

    • Oxygen levels affect respiratory phenotypes

    • Temperature sensitivity may reveal conditional phenotypes

To overcome these challenges, researchers should:

  • Use chemically defined media with controlled metal concentrations

  • Include appropriate control strains (wild-type, known transport mutants)

  • Test multiple growth conditions (carbon sources, metal availability, temperature)

  • Consider double or triple mutants to address functional redundancy

How can researchers differentiate between iron and copper transport functions of MRS3 experimentally?

Differentiating between the iron and copper transport functions of MRS3 requires carefully designed experiments:

  • Metal-specific complementation assays:

    • Test whether excess copper can rescue iron-limited phenotypes and vice versa

    • Use copper or iron chelators selectively to create specific deficiency conditions

  • Metal-specific transport assays:

    • Measure 64Cu and 55Fe uptake separately in isolated mitochondria

    • Use competition assays to determine relative affinities

  • Metal-dependent protein activation:

    • Monitor activity of copper-dependent enzymes (cytochrome c oxidase)

    • Monitor activity of iron-dependent enzymes (aconitase, succinate dehydrogenase)

    • Use metal-specific biosensors targeted to mitochondria

  • Genetic approaches:

    • Create MRS3 mutants with altered metal specificity through directed evolution

    • Perform genetic interaction studies with known copper-specific and iron-specific proteins

This multifaceted approach can help resolve the relative contributions of MRS3 to iron and copper homeostasis under different conditions .

How should researchers interpret contradictory results between in vivo and in vitro MRS3 transport studies?

When faced with contradictory results between in vivo and in vitro studies of MRS3 transport, researchers should consider:

  • System complexity differences:

    • In vivo systems include the complete cellular environment with all regulatory mechanisms

    • In vitro systems (isolated mitochondria, reconstituted proteoliposomes) lack many regulatory factors

  • Methodological considerations:

    • Verify protein integrity and orientation in reconstituted systems

    • Confirm mitochondrial purity and integrity in organelle isolation

    • Validate antibody specificity for western blots and immunolocalization

  • Resolution approaches:

    • Create intermediate complexity systems (semi-permeabilized cells, isolated but intact organelles)

    • Develop improved in vitro reconstitution systems that incorporate key regulatory components

    • Use genetic approaches to manipulate specific factors that might explain discrepancies

  • Integration strategies:

    • Develop mathematical models that account for differences between systems

    • Consider that contradictions might reveal important regulatory mechanisms

    • Use complementary techniques to validate key findings

The dual functionality of MRS3 in transporting both iron and copper demonstrated in different experimental systems illustrates how seemingly contradictory results can lead to expanded understanding of protein function .

What statistical approaches are most appropriate for analyzing MRS3 mutant phenotypes across different conditions?

For robust analysis of MRS3 mutant phenotypes, the following statistical approaches are recommended:

  • For growth phenotype analysis:

    • Repeated measures ANOVA for growth curves

    • Area under curve (AUC) calculations for integrated growth assessment

    • Principal component analysis for multivariate condition comparison

  • For metal content measurements:

    • Paired t-tests when comparing isogenic strains

    • Multiple regression analysis to identify relationships between metal levels and phenotypes

    • ANCOVA when controlling for covariates like growth rate

  • For enzyme activity correlations:

    • Pearson or Spearman correlation between metal levels and enzyme activities

    • Multiple comparison correction (e.g., Bonferroni, FDR) when measuring multiple activities

    • Path analysis to identify causal relationships

  • For high-throughput data integration:

    • Gene set enrichment analysis for transcriptomic responses

    • Hierarchical clustering to identify patterns across conditions

    • Machine learning approaches for predictive phenotype modeling

The comprehensive approach used in genome-wide studies of S. cerevisiae provides a model for statistical handling of complex phenotypic data that can be applied to MRS3 research .

What are promising approaches for studying MRS3 interactions with the broader mitochondrial proteome?

Future research on MRS3 interactions with the mitochondrial proteome should consider:

  • Advanced proteomic approaches:

    • Proximity-dependent biotinylation (BioID, TurboID) to identify proteins in close proximity to MRS3

    • APEX2-based proximity labeling for temporal interaction mapping

    • Quantitative crosslinking mass spectrometry to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

  • Functional genomic screens:

    • CRISPR interference/activation screens to identify genetic modifiers of MRS3 function

    • Synthetic genetic array analysis to map genetic interaction networks

    • Suppressor screens to identify compensatory pathways

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize MRS3 distribution within mitochondrial subcompartments

    • FRET-based sensors to detect protein-protein interactions in live cells

    • Split fluorescent protein complementation to validate specific interactions

These approaches would extend our understanding beyond the established functional overlap with PIC2 to a comprehensive view of how MRS3 integrates into mitochondrial metal homeostasis networks .

How might understanding MRS3 function contribute to broader research on mitochondrial diseases?

Understanding MRS3 function has significant implications for mitochondrial disease research:

  • Relevance to human health:

    • Human orthologs of MRS3 may play similar roles in mitochondrial metal homeostasis

    • Disruptions in metal transport are implicated in neurodegenerative diseases

    • Mitochondrial copper metabolism is linked to conditions like Menkes and Wilson diseases

  • Therapeutic target potential:

    • Modulation of mitochondrial metal transport could alleviate symptoms in diseases with metal imbalances

    • Understanding compensatory mechanisms could reveal therapeutic approaches

    • Small molecules targeting specific transport functions might allow precise intervention

  • Biomarker development:

    • Metal transport defects might produce specific metabolic signatures useful for diagnosis

    • Understanding the MRS3 pathway could identify early markers of mitochondrial dysfunction

  • Model system advantages:

    • S. cerevisiae provides a genetically tractable system for studying conserved aspects of mitochondrial biology

    • Findings in yeast can guide more focused studies in mammalian systems

The dual role of MRS3 in iron and copper transport highlights the interconnected nature of mitochondrial metal homeostasis, suggesting that therapeutic approaches might need to consider multiple transport systems simultaneously .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.