Recombinant Saccharomyces cerevisiae Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Description

Comparison to Related Transporters

Despite being the closest yeast relative to the human deoxynucleotide carrier (DNC), TPC1 shares only 25% sequence identity with this protein, indicating they are not orthologs. This limited homology is reflected in their distinct functional properties and substrate specificities . The table below highlights key differences between these transporters:

FeatureS. cerevisiae TPC1Human DNC
Sequence identityReference25% identity to TPC1
Transport mechanismUniport and exchangeObligatory counter-exchange only
ThPP transportEfficientNo significant transport
Response to inhibitorsUnaffected by carboxyatractyloside and bongkrekic acidInhibited by these compounds
Complementation ability-Cannot complement tpc1Δ strain

Recombinant Expression and Purification

Recombinant production of Saccharomyces cerevisiae TPC1 has been achieved through various expression systems, with Escherichia coli being the most commonly utilized host organism.

Expression Systems

The full-length TPC1 protein (1-314 amino acids) has been successfully expressed in E. coli with an N-terminal histidine tag to facilitate purification . The recombinant protein is typically supplied as a lyophilized powder requiring reconstitution before use . Proper storage conditions are critical for maintaining protein activity, with recommendations for storage at -20°C/-80°C and avoidance of repeated freeze-thaw cycles .

Purification and Reconstitution

The purification process for recombinant TPC1 involves several critical steps:

  1. Solubilization from bacterial membranes using specific detergents

  2. Affinity chromatography purification, typically utilizing the N-terminal histidine tag

  3. Reconstitution into phospholipid vesicles (liposomes) for functional studies

For functional reconstitution, TPC1 is typically solubilized using 1.8% sarkosyl followed by incorporation into liposomes according to established protocols . This reconstitution into an artificial membrane environment allows for detailed characterization of transport properties through various assay systems.

Transport Properties and Substrate Specificity

Functional studies with reconstituted recombinant TPC1 have revealed its specific transport capabilities and substrate preferences, distinguishing it from other mitochondrial carriers.

Transport Mechanisms

TPC1 demonstrates considerable versatility in its transport mechanisms, capable of catalyzing both:

  1. Uniport: Unidirectional transport of substrates

  2. Exchange: Counter-exchange of internal and external substrates

This dual capability distinguishes TPC1 from many other mitochondrial carriers that function exclusively through exchange mechanisms, such as the human deoxynucleotide carrier .

Substrate Specificity

The substrate spectrum of TPC1 has been thoroughly characterized through transport assays with reconstituted protein. The highest transport activities were observed for:

  1. Thiamine pyrophosphate (ThPP) - primary physiological substrate

  2. Thiamine monophosphate (ThMP)

To a lesser extent, TPC1 also transports nucleotides including dAMP, dADP, and ADP . Importantly, TPC1 exhibits no significant transport activity for thiamine, nucleosides, purines, and pyrimidines, confirming its highly specific substrate recognition .

pH Dependence

Transport kinetics of TPC1 demonstrate distinct pH dependencies based on the transport mode:

  • Uniport activity increases with decreasing external pH and increasing internal pH

  • Exchange reactions show minimal pH sensitivity

These pH characteristics suggest that TPC1 may transport ThPP together with a proton or in exchange for a hydroxyl ion, providing insights into the molecular mechanisms of transport .

Physiological Significance

Deletion studies in Saccharomyces cerevisiae have elucidated the critical physiological roles of TPC1 in cellular metabolism and cofactor homeostasis.

Role in Thiamine Pyrophosphate Trafficking

The primary physiological function of TPC1 appears to be the transport of cytosolically synthesized thiamine pyrophosphate into mitochondria . This transport is essential because:

  1. Thiamine pyrophosphate is synthesized exclusively in the cytosol by thiamine pyrophosphokinase

  2. Several essential mitochondrial enzymes require thiamine pyrophosphate as a cofactor

  3. No alternative synthesis pathway for thiamine pyrophosphate exists within mitochondria

Impact on Mitochondrial Enzymes

Deletion of the TPC1 gene (tpc1Δ) results in significant reductions in the activities of mitochondrial thiamine pyrophosphate-dependent enzymes, notably:

EnzymeActivity in tpc1Δ vs. Wild-typeRestoration with ThPP Addition
Acetolactate synthase (ALS)5-fold lowerNearly complete
Oxoglutarate dehydrogenase (OGDH)4-fold lowerComplete
Pyruvate decarboxylase (cytosolic)No significant differenceNo change

These findings demonstrate that TPC1 deletion specifically affects mitochondrial thiamine pyrophosphate-dependent enzymes while leaving cytosolic enzymes unaffected .

Growth Phenotypes

The tpc1Δ strain exhibits distinctive growth phenotypes that provide further insights into TPC1 function:

  1. On synthetic minimal medium with fermentative carbon sources (glucose, galactose):

    • Displays thiamine auxotrophy (cannot grow without thiamine supplementation)

    • Growth is restored by complementation with the TPC1-pRS416 plasmid

  2. On synthetic minimal medium with non-fermentative carbon sources:

    • Growth comparable to wild-type, even without thiamine supplementation

    • Suggests an alternative thiamine pyrophosphate transport mechanism under respiratory conditions

These observations indicate that TPC1 function is particularly critical during fermentative growth conditions, with alternative transport systems potentially active during respiratory metabolism.

Carbon Source-Dependent Regulation

A striking finding from studies of TPC1 is the apparent regulation of its expression and activity by carbon source, suggesting sophisticated control mechanisms for thiamine pyrophosphate homeostasis.

Evidence for Differential Expression

Several lines of evidence suggest that TPC1 expression or activity is regulated by carbon source:

  1. The tpc1Δ strain grows normally on non-fermentative carbon sources without thiamine supplementation

  2. Mitochondrial thiamine pyrophosphate levels in tpc1Δ cells are significantly reduced on fermentative substrates but normal on non-fermentative substrates

  3. Cytosolic accumulation of thiamine pyrophosphate occurs in tpc1Δ cells on fermentative but not non-fermentative substrates

Alternative Transport Systems

The growth characteristics and thiamine pyrophosphate distribution patterns in tpc1Δ cells strongly suggest the existence of an alternative mitochondrial thiamine pyrophosphate transport system that operates primarily under respiratory conditions . The identity of this alternative transporter remains to be determined but may involve one of the mitochondrial carriers known to be upregulated during the diauxic shift from fermentation to respiration.

Applications of Recombinant TPC1

Recombinant Saccharomyces cerevisiae TPC1 has found various applications in biochemical and cellular research.

Research Applications

Commercially available recombinant TPC1 proteins serve as valuable tools for:

  1. Positive controls in protein detection assays

  2. Immunogens for antibody production

  3. Analytical standards for techniques such as SDS-PAGE and Western blotting

These applications leverage the availability of purified recombinant protein with defined characteristics and reliable quality.

Model System for Mitochondrial Transport

The thorough characterization of TPC1 has established it as an important model system for studying:

  1. Mitochondrial carrier family transport mechanisms

  2. Substrate recognition determinants

  3. Regulation of cofactor transport between cellular compartments

These studies contribute to our broader understanding of mitochondrial carrier proteins and their roles in cellular metabolism.

Future Research Directions

Despite significant advances in our understanding of TPC1, several important questions remain for future investigation.

Identification of the Alternative Transporter

The identification and characterization of the proposed alternative thiamine pyrophosphate transporter active under respiratory conditions would complete our understanding of mitochondrial thiamine pyrophosphate homeostasis.

Therapeutic Implications

Given the essential role of thiamine pyrophosphate in cellular metabolism, understanding its transport systems may have implications for:

  1. Yeast biotechnology applications

  2. Understanding human thiamine deficiency disorders

  3. Developing strategies to manipulate cellular metabolism for industrial applications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us, and we will prioritize its implementation.
Synonyms
TPC1; SCY_2311; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
TPC1
Target Protein Sequence
MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVM EVARSMIKNEGIRAFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGA FAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITL TASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS FWGYETAIHYLRMY
Uniprot No.

Target Background

Function
Mitochondrial transporter mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of TPC1 in Saccharomyces cerevisiae?

TPC1 (Thiamine Pyrophosphate Carrier) functions as the mitochondrial carrier for thiamine pyrophosphate (ThPP), an essential cofactor. The protein is encoded by the YGR096w gene in S. cerevisiae and belongs to the mitochondrial carrier family. Its primary role is to catalyze the uniport uptake of ThPP from the cytosol into mitochondria, where this cofactor is required for the activity of several matrix enzymes . TPC1 also exhibits the ability to transport ThMP (thiamine monophosphate) and, to a lesser extent, some structurally related nucleotides, though not thiamine itself, nucleosides, purines, or pyrimidines .

How does TPC1 relate to mitochondrial metabolism?

TPC1 is crucial for maintaining proper mitochondrial metabolism by ensuring adequate supply of ThPP to ThPP-dependent enzymes in the mitochondrial matrix. These enzymes include acetolactate synthase (ALS) and the E1 components of pyruvate dehydrogenase and oxoglutarate dehydrogenase (OGDH) . When TPC1 is deleted, cells exhibit reduced intramitochondrial levels of ThPP, decreased activities of ALS and OGDH, and require thiamine supplementation for growth on fermentative carbon sources . This demonstrates TPC1's essential role in linking cytosolic thiamine metabolism with mitochondrial energetic functions.

What is known about TPC1's impact on cellular aging?

Studies indicate that TPC1 is necessary for normal replicative lifespan in S. cerevisiae. Deletion of the TPC1 gene results in a 20% decrease in replicative lifespan in the alpha strain . This positions TPC1 in the "necessary for fitness" longevity category, suggesting its role extends beyond basic metabolic functions to influence cellular aging processes . The mechanism behind this lifespan reduction likely involves compromised mitochondrial function due to insufficient ThPP availability for essential metabolic enzymes.

What are the recommended methods for expressing recombinant TPC1 in bacterial systems?

For expressing recombinant TPC1, the following methodology has proven effective:

  • Clone the TPC1 coding sequence into a bacterial expression vector containing an appropriate promoter and affinity tag.

  • Transform the construct into a bacterial host (E. coli BL21 or similar strains are commonly used).

  • Induce expression with IPTG or appropriate inducer under optimized conditions (typically 18-25°C to enhance proper folding of membrane proteins).

  • Extract the protein using detergent solubilization (e.g., n-dodecyl-β-D-maltoside) of bacterial membranes.

  • Purify using affinity chromatography based on the incorporated tag.

  • Verify expression by Western blotting using antibodies against the affinity tag or TPC1 itself .

This approach has been successfully used to produce functional TPC1 for reconstitution and transport studies .

How can TPC1 be functionally reconstituted into liposomes for transport studies?

Functional reconstitution of TPC1 into liposomes involves the following key steps:

  • Prepare liposomes using a mixture of phospholipids (typically egg yolk phospholipids) by sonication.

  • Add purified TPC1 protein to the preformed liposomes at a protein:lipid ratio of approximately 1:100.

  • Create unilamellar liposomes through freeze-thaw cycles followed by extrusion through polycarbonate filters.

  • Remove external substrate by gel filtration chromatography.

  • Assess transport activity by measuring substrate uptake using radiolabeled compounds (e.g., [³H]ThPP).

  • Analyze transport kinetics to determine substrate specificity, Km values, and effects of inhibitors .

This reconstitution system allows for detailed characterization of TPC1's transport properties, including substrate specificity, transport mechanism (uniport vs. exchange), and inhibitor sensitivity.

What methods are recommended for analyzing TPC1 deletion effects on mitochondrial function?

To comprehensively analyze the effects of TPC1 deletion on mitochondrial function:

  • Generate TPC1 knockout strains using homologous recombination or CRISPR-Cas9 approaches.

  • Isolate mitochondria using differential centrifugation.

  • Measure ThPP levels in isolated mitochondria using HPLC or enzymatic assays.

  • Assess the activities of ThPP-dependent enzymes (ALS, pyruvate dehydrogenase, OGDH) using spectrophotometric assays.

  • Analyze mitochondrial respiration using oxygen consumption measurements.

  • Evaluate growth characteristics under different carbon sources, particularly noting thiamine requirements.

  • Perform replicative lifespan analysis using micromanipulation to track mother cell divisions .

This multi-parameter approach provides comprehensive insights into how TPC1 deletion affects mitochondrial metabolism and cellular fitness.

How does TPC1 interact with other components of mitochondrial carrier systems?

While TPC1 functions primarily as an independent carrier protein, research should address potential interactions with other mitochondrial transport systems through:

  • Co-immunoprecipitation experiments with tagged TPC1 to identify interacting proteins.

  • Blue native PAGE analysis to detect potential carrier complexes.

  • Genetic interaction screens using synthetic genetic array (SGA) methodology to identify functional relationships with other carriers.

  • Lipidomic analysis to determine if TPC1 function is influenced by specific phospholipid environments.

  • Structural studies using cryo-EM or X-ray crystallography to resolve potential interaction interfaces.

The carrier's relation to other transport systems may reveal regulatory mechanisms that coordinate ThPP import with broader metabolic needs.

What is the relationship between TPC1 function and cellular responses to metabolic stress?

To investigate TPC1's role in metabolic stress responses:

  • Subject wild-type and TPC1-deficient cells to various stressors (oxidative stress, nutrient limitation, temperature shifts).

  • Monitor ThPP transport rates under stress conditions in reconstituted systems.

  • Analyze transcriptional and proteomic changes in response to stress in the presence and absence of TPC1.

  • Examine mitochondrial morphology and dynamics during stress responses.

  • Measure reactive oxygen species production and antioxidant defense mechanisms.

This approach reveals whether TPC1 functions extend beyond basic transport to include roles in cellular stress adaptation, which may explain its impact on replicative lifespan .

How do post-translational modifications affect TPC1 activity and regulation?

Investigation of post-translational modifications (PTMs) of TPC1 should include:

  • Mass spectrometry analysis of purified TPC1 to identify phosphorylation, acetylation, or other modifications.

  • Site-directed mutagenesis of identified modification sites to create modification-mimicking or modification-resistant variants.

  • Transport assays with modified and unmodified forms of the protein.

  • Temporal analysis of modifications under different metabolic conditions.

  • Identification of kinases, acetyltransferases, or other enzymes responsible for the modifications.

Understanding PTMs provides insights into how TPC1 activity might be regulated in response to changing cellular needs or metabolic states.

How conserved is TPC1 function across different species and what can be learned from its homologs?

TPC1 has homologs in multiple organisms, providing opportunities for comparative studies:

OrganismHomologSequence Identity to S. cerevisiae TPC1
Homo sapiensSLC25A19~25%
Mus musculusSlc25a19Similar to human
Caenorhabditis eleganshpo-12, F47B8.10Not specified
Drosophila melanogasterTpc1, Tpc2Not specified
Schizosaccharomyces pombeSPBC1604.04Not specified

Research approaches should include:

  • Functional complementation studies by expressing homologs in S. cerevisiae TPC1 deletion strains.

  • Comparative transport assays using reconstituted systems.

  • Structural modeling to identify conserved functional domains.

  • Analysis of species-specific differences in regulation and substrate specificity .

Notably, the human homolog SLC25A19 does not complement the thiamine auxotrophy of TPC1-deficient yeast, indicating functional divergence despite sequence similarity .

What distinguishes TPC1 from other members of the mitochondrial carrier family?

TPC1 can be distinguished from other mitochondrial carriers through:

  • Substrate specificity analysis showing preference for ThPP and ThMP over other nucleotides.

  • Transport mechanism studies revealing TPC1's ability to catalyze both uniport and exchange reactions, unlike some carriers that only perform counter-exchange.

  • Inhibitor sensitivity profiles, particularly noting TPC1's resistance to carboxyatractyloside and bongkrekic acid (inhibitors of the ADP/ATP carrier).

  • Structural features, especially within the substrate binding site.

  • Expression patterns and regulation in response to thiamine availability .

These distinguishing characteristics position TPC1 as a specialized carrier evolved to meet the specific needs of mitochondrial ThPP-dependent metabolism.

How should researchers address contradictory data when studying TPC1 function across different experimental systems?

When confronting contradictory data in TPC1 research:

  • Systematically evaluate methodological differences between studies, including:

    • Strain backgrounds and genetic modifications

    • Growth conditions and media composition

    • Extraction and purification protocols

    • Assay conditions and detection methods

  • Perform direct comparative experiments under standardized conditions.

  • Consider the possibility of context-dependent functions by examining:

    • Metabolic state of the cells

    • Genetic background effects

    • Environmental influences on TPC1 activity

  • Integrate multiple methodological approaches (genetic, biochemical, structural) to build a comprehensive understanding .

  • Document extensively all experimental parameters to facilitate reproduction and comparison of results.

This systematic approach helps distinguish genuine biological complexities from technical artifacts when contradictory results emerge .

What are the key considerations for designing gene deletion experiments to study TPC1 function?

When designing TPC1 deletion experiments, researchers should consider:

  • Selection of appropriate strain backgrounds, as deletion effects may vary between laboratory strains.

  • Implementation of proper controls:

    • Wild-type parental strain

    • Complemented deletion strain expressing TPC1 from a plasmid

    • Strains expressing site-directed mutants to distinguish essential residues

  • Phenotypic analyses across multiple parameters:

    • Growth rates in different media (with and without thiamine)

    • Mitochondrial enzyme activities (especially ThPP-dependent enzymes)

    • Replicative and chronological lifespan measurements

    • Stress resistance profiles

  • Consideration of potential compensatory mechanisms that may mask deletion effects:

    • Upregulation of alternative transport pathways

    • Metabolic rewiring to bypass ThPP-dependent reactions

  • Time-course experiments to distinguish immediate from adaptive responses to TPC1 absence .

These considerations help ensure that experimental designs capture the full spectrum of TPC1 functions while accounting for biological complexity.

What are the most promising approaches for resolving the structure of TPC1?

To advance structural understanding of TPC1:

  • Apply cryo-electron microscopy (cryo-EM) techniques that have successfully resolved structures of other mitochondrial carriers.

  • Utilize advanced protein expression systems:

    • Insect cell expression for increased protein yield

    • Yeast expression systems that maintain native post-translational modifications

    • Cell-free expression systems for rapid screening of stabilizing conditions

  • Develop thermal shift assays to identify conditions and ligands that stabilize TPC1 structure.

  • Implement protein engineering approaches:

    • Fusion of stabilizing domains

    • Introduction of disulfide bonds

    • Surface entropy reduction

  • Explore lipid cubic phase crystallization methods that have proven successful for other membrane proteins.

These approaches can overcome the typical challenges associated with membrane protein structure determination and provide insights into TPC1's transport mechanism.

How might understanding TPC1 function contribute to aging research and mitochondrial disease models?

The relationship between TPC1 and cellular aging offers several research opportunities:

  • Investigate whether TPC1 overexpression extends lifespan beyond wild-type levels.

  • Examine the impact of TPC1 variants on aging-related phenotypes:

    • Mitochondrial morphology changes with age

    • Accumulation of damage to mitochondrial proteins

    • Changes in cellular energy metabolism

  • Explore the connection between ThPP availability and age-related mitochondrial dysfunction:

    • Measure ThPP levels in young versus aged cells

    • Assess ThPP-dependent enzyme activities across lifespan

    • Test whether ThPP supplementation affects aging phenotypes

  • Develop yeast models of human SLC25A19-related diseases:

    • Create humanized yeast expressing SLC25A19 variants

    • Test whether pathogenic mutations affect ThPP transport

    • Screen for compounds that rescue transport defects .

These investigations may reveal new connections between cofactor transport, mitochondrial function, and cellular aging mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.