Recombinant Saccharomyces cerevisiae N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase (GPI12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize development of the specified tag.
Synonyms
GPI12; YMR281W; YM8021.07; N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
GPI12
Target Protein Sequence
MKMLRRTKVNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDVYTY
Uniprot No.

Target Background

Function
This protein is involved in the second step of GPI biosynthesis. It catalyzes the de-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.
Database Links

KEGG: sce:YMR281W

STRING: 4932.YMR281W

Protein Families
PIGL family
Subcellular Location
Endoplasmic reticulum membrane.

Q&A

What is the biological role of GPI12 in Saccharomyces cerevisiae?

GPI12 in Saccharomyces cerevisiae (encoded by the YMR281W open reading frame) is an essential enzyme involved in the second step of glycosylphosphatidylinositol (GPI) biosynthesis. Specifically, it catalyzes the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). This enzymatic activity is critical for the subsequent steps in GPI anchor synthesis, which ultimately allow for the attachment of various proteins to the cell membrane. The disruption of the GPI12 gene in S. cerevisiae results in lethality, demonstrating that this de-N-acetylation step is indispensable for yeast viability .

The enzyme functions within the early stages of the highly conserved GPI biosynthetic pathway found across eukaryotes. By catalyzing the conversion of GlcNAc-PI to glucosaminylphosphatidylinositol (GlcN-PI), GPI12 enables the progression of GPI anchor synthesis. This process ultimately provides the mechanisms by which numerous proteins become anchored to the cell surface, playing crucial roles in cell wall integrity, intercellular communication, and environmental sensing .

How conserved is GPI12 across different species?

GPI12 demonstrates significant evolutionary conservation across diverse eukaryotic species, though with notable structural and functional variations. The S. cerevisiae GPI12 protein (Gpi12p) shares approximately 24% amino acid identity with its mammalian homolog, rat PIG-L. Despite this relatively modest sequence identity, these enzymes perform the same fundamental catalytic function in GPI biosynthesis .

Functional conservation has been demonstrated experimentally: the S. cerevisiae GPI12 gene successfully restores cell-surface expression of GPI-anchored proteins and GlcNAc-PI de-N-acetylase activity when transfected into mammalian PIG-L-deficient cells . Similarly, Candida albicans GPI12 (CaGpi12) recognizes GlcNAc-PI from S. cerevisiae and can complement ScGPI12 function, demonstrating conservation within fungal species .

Cross-species analysis reveals interesting differences in metal ion preferences and enzymatic characteristics despite the shared catalytic function:

SpeciesKey CharacteristicsMetal Ion PreferenceOptimal Conditions
S. cerevisiaeEssential for viabilityEnhanced by Mn²⁺, Ni²⁺Not fully characterized
C. albicansEssential for growth and cell wall integrityStimulated by divalent cations, no preference for Zn²⁺30°C, pH 7.5
Mammals (PIG-L)Enhanced by GTPPreference for Zn²⁺Varies by organism

These differences present opportunities for species-specific targeting in antifungal drug development while highlighting the fundamental conservation of this critical enzymatic function across eukaryotes .

What are the optimal conditions for measuring recombinant S. cerevisiae GPI12 activity in vitro?

Measuring recombinant S. cerevisiae GPI12 activity in vitro requires careful consideration of experimental conditions based on the enzyme's biochemical properties. While the precise optimal conditions for S. cerevisiae GPI12 have not been fully characterized in the available research, evidence from studies on homologous enzymes provides valuable guidance.

Based on characterization of the related Candida albicans GPI12 (CaGpi12), which can complement S. cerevisiae GPI12 function, the following conditions likely support optimal activity:

  • Temperature: Approximately 30°C, which aligns with the optimal growth temperature of S. cerevisiae and the demonstrated optimal temperature for CaGpi12 .

  • pH: Around 7.5, as shown optimal for CaGpi12 activity .

  • Metal ions: The inclusion of divalent cations, particularly Mn²⁺ and Ni²⁺, which significantly enhance the enzyme activity of mammalian PIG-L and likely play similar roles in yeast homologs .

A methodological approach for measuring activity would include:

  • Preparation of rough endoplasmic reticulum microsomes containing the enzyme

  • Generation of radiolabeled GlcNAc-PI substrate

  • Incubation of enzyme with substrate under controlled conditions

  • Analysis of reaction products using thin-layer chromatography and autoradiography or liquid chromatography-mass spectrometry

Researchers should be aware that unlike mammalian PIG-L, yeast GPI12 activity may not be enhanced by GTP, representing a significant species-specific difference in regulation .

What purification strategies are most effective for isolating recombinant S. cerevisiae GPI12?

Purification of recombinant S. cerevisiae GPI12 requires strategies that account for its biochemical properties and subcellular localization. Based on research with homologous proteins, the following multi-step approach is recommended:

  • Expression System Selection:

    • E. coli expression systems have been successfully used for rat PIG-L, where the recombinant protein was recovered as a complex with the chaperone GroEL .

    • Alternatively, yeast expression systems utilizing S. cerevisiae or Pichia pastoris offer the advantage of proper eukaryotic post-translational modifications.

  • Affinity Tag Strategy:

    • N-terminal or C-terminal polyhistidine tags (His₆) facilitate purification via immobilized metal affinity chromatography (IMAC).

    • Note that both N- and C-terminal domains are important for CaGpi12 function, suggesting tag position may affect activity .

  • Membrane Protein Considerations:

    • As an ER-associated enzyme, detergent solubilization is likely necessary.

    • A combination of mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) at concentrations above their critical micelle concentration can effectively solubilize the protein while preserving activity.

  • Chromatographic Purification Sequence:

    • IMAC as the initial capture step

    • Ion exchange chromatography as an intermediate purification step

    • Size exclusion chromatography as a final polishing step

  • Metal Ion Management:

    • Include appropriate divalent cations (particularly Mn²⁺ or Ni²⁺) in purification buffers to maintain activity .

    • Avoid metal chelators like EDTA, which can irreversibly inactivate the enzyme as demonstrated with CaGpi12 .

The purified enzyme should be stored with stabilizing agents and divalent cations at -80°C to preserve activity. Validation of enzymatic activity following purification is essential, as the removal from its native membrane environment may affect structural integrity and function.

How can researchers analyze the impact of GPI12 mutations on GPI biosynthesis and cell viability?

Analyzing the impact of GPI12 mutations presents unique challenges due to the gene's essentiality in S. cerevisiae. Researchers can employ several complementary approaches to characterize how specific mutations affect GPI biosynthesis and cell viability:

  • Conditional Expression Systems:

    • Tetracycline-regulated promoters or glucose/galactose-regulated promoters (like GAL1) can control GPI12 expression.

    • These systems allow researchers to study the consequences of GPI12 depletion over time and determine the minimum expression level required for viability.

  • Site-Directed Mutagenesis:

    • Target conserved motifs such as HPDDE and HXXH, which are critical for function in the C. albicans homolog .

    • Complementation assays can determine if mutated versions can rescue GPI12-deficient cells.

    • Partial loss-of-function mutations may reveal phenotypes less severe than lethality.

  • Biochemical Analysis of Mutant Enzymes:

    • In vitro enzyme assays using radiolabeled GlcNAc-PI substrate to quantify de-N-acetylase activity.

    • Kinetic parameters (Km, Vmax) can be determined for mutant enzymes to understand how mutations affect substrate binding and catalytic efficiency.

  • Cell Wall Integrity Assays:

    • Since GPI-anchored proteins contribute to cell wall structure, mutations in GPI12 likely affect cell wall integrity.

    • Assays using cell wall stressors (Congo Red, Calcofluor White) can reveal cell wall defects.

    • Cell wall composition analysis can identify specific alterations in β-glucans, mannoproteins, and chitin content.

  • Analysis of GPI-Anchored Protein Trafficking:

    • Fluorescence microscopy of GFP-tagged GPI-anchored proteins can track their localization.

    • Flow cytometry can quantify cell surface expression of GPI-anchored proteins.

    • Biochemical fractionation can determine the relative abundance of proteins in different cellular compartments.

When designing these experiments, researchers should consider that complete loss of GPI12 function is lethal in S. cerevisiae , necessitating approaches that allow the study of partial loss-of-function or conditional depletion.

What methodologies can effectively compare the functional differences between S. cerevisiae GPI12 and its mammalian homolog PIG-L?

Comparative analysis of S. cerevisiae GPI12 and mammalian PIG-L requires methodologies that address both enzymatic activity and biological function. The following approaches enable systematic comparison:

  • Heterologous Expression and Complementation:

    • Express S. cerevisiae GPI12 in mammalian PIG-L-deficient cell lines and assess restoration of GPI-anchored protein expression .

    • Conversely, express mammalian PIG-L in S. cerevisiae GPI12 knockout strains with a conditional wild-type GPI12 allele.

    • Quantify the efficiency of cross-species complementation through growth rates, GPI-anchored protein levels, and GlcNAc-PI de-N-acetylase activity.

  • Biochemical Characterization Under Standardized Conditions:

    • Compare enzyme kinetics (Km, Vmax, kcat) using identical substrate preparations.

    • Evaluate pH and temperature profiles to identify optimal conditions for each enzyme.

    • Assess metal ion dependence, with particular attention to differential responses to Mn²⁺, Ni²⁺, and Zn²⁺ .

    • Determine the effect of GTP on enzymatic activity, which enhances mammalian but not necessarily yeast enzyme activity .

  • Structural Biology Approaches:

    • Generate homology models based on crystallographic data if available.

    • Use techniques such as hydrogen-deuterium exchange mass spectrometry to identify regions with differential dynamics.

    • Employ site-directed mutagenesis to evaluate the functional importance of non-conserved residues.

  • Domain Swap Experiments:

    • Create chimeric enzymes by exchanging domains between yeast and mammalian proteins.

    • Assess which regions confer species-specific properties such as metal preference or GTP responsiveness.

  • Protein-Protein Interaction Analysis:

    • Identify interaction partners through techniques such as affinity purification-mass spectrometry.

    • Compare the interactomes of yeast and mammalian enzymes to understand differences in regulatory networks.

This comparative data can be organized as follows:

PropertyS. cerevisiae GPI12Mammalian PIG-LMethod of Comparison
Primary sequence identityBaseline~24% identity with ScGPI12Sequence alignment
Metal ion dependenceEnhanced by Mn²⁺, Ni²⁺Preference for Zn²⁺Enzyme activity assays with various metals
GTP enhancementNot observedPresentActivity assays ± GTP
Optimal temperature~30°C (inferred)37°C (mammalian physiological)Temperature-activity profiles
Complementation abilityCan restore function in PIG-L-deficient cellsTo be determinedHeterologous expression

These methodologies provide a comprehensive framework for understanding the evolutionary divergence and conservation of this essential enzyme .

How can CRISPR-Cas9 genome editing be applied to investigate GPI12 function and regulatory networks in S. cerevisiae?

CRISPR-Cas9 genome editing offers powerful approaches for investigating GPI12 function and its regulatory networks in S. cerevisiae, despite the gene's essentiality. Researchers can employ the following sophisticated strategies:

  • Precise Genomic Modifications:

    • Generation of conditional alleles by inserting regulatable promoters upstream of the GPI12 coding sequence.

    • Introduction of point mutations to create hypomorphic alleles that maintain partial function while revealing phenotypes less severe than lethality.

    • Integration of epitope tags or fluorescent protein fusions at the endogenous locus to monitor protein levels, localization, and dynamics without disrupting function.

  • Auxiliary Component Manipulation:

    • Systematic editing of genes encoding proteins that interact with GPI12 or function in the same pathway.

    • Creation of double mutants combining non-lethal mutations in GPI12 with mutations in other GPI biosynthesis genes to identify genetic interactions and compensatory mechanisms.

    • Targeting transcription factors and regulatory elements that control GPI12 expression.

  • CRISPR Interference and Activation Systems:

    • Deployment of dCas9-based systems (CRISPRi/CRISPRa) to modulate GPI12 expression without permanent genetic changes.

    • Titration of expression levels to determine minimal requirements for various cellular functions.

    • Temporal control of expression to study acute versus chronic effects of GPI12 depletion.

  • Multiplexed Screening Approaches:

    • Genome-wide CRISPR screens in strains with compromised GPI12 function to identify synthetic lethal interactions.

    • Screens for suppressors that rescue growth defects in GPI12 hypomorphic mutants.

    • Parallel editing of multiple GPI pathway components to understand pathway plasticity and compensatory mechanisms.

  • Base and Prime Editing Applications:

    • Introduction of specific nucleotide changes without requiring double-strand breaks or homology-directed repair.

    • Systematic mutation of conserved motifs (HPDDE and HXXH) to assess their contribution to enzyme function .

    • Creation of allelic series with varying degrees of functional impairment.

When implementing these strategies, researchers should consider that complete disruption of GPI12 is lethal in S. cerevisiae , necessitating approaches that either preserve some level of function or provide alternative pathways for cell survival. The experimental design should include appropriate controls and validation steps to confirm the specificity and efficiency of the genome editing events.

How does the evolutionary conservation of GPI12 across fungal species inform antifungal drug development strategies?

The evolutionary conservation of GPI12 across fungal species presents both opportunities and challenges for antifungal drug development. A comprehensive analysis of this enzyme across pathogenic and non-pathogenic fungi reveals potential therapeutic strategies:

  • Comparative Analysis of Conservation Patterns:

    • GPI12 shows essential functions across multiple fungal species, including S. cerevisiae and Candida albicans, making it an attractive broad-spectrum target .

    • The enzyme's essentiality in fungi contrasts with variable requirements in other eukaryotes; for example, GPI12 knockout has been obtained in the promastigote stage of Leishmania major, although with decreased infectivity .

    • Sequence alignment across fungal species identifies invariant residues that may be critical for function and thus promising drug targets.

  • Structural and Functional Divergence from Human Homologs:

    • While fungal GPI12 and human PIG-L share the same enzymatic function, they exhibit only 24% sequence identity, suggesting structural differences that can be exploited .

    • Differential metal ion preferences between fungal (Mn²⁺/Ni²⁺) and mammalian (Zn²⁺) enzymes provide a biochemical basis for selective inhibition .

    • The conserved motifs HPDDE and HXXH are critical for fungal GPI12 function and may represent specific targeting sites .

SpeciesEssentialityKey Structural FeaturesPotential for Target Selectivity
S. cerevisiaeEssential (lethal when disrupted)Mn²⁺/Ni²⁺ preferenceHigh
C. albicansEssential; associated with cell wall integrityConserved HPDDE and HXXH motifsHigh
Humans (PIG-L)Essential but structurally distinctZn²⁺ preference, GTP enhancement-
L. majorNon-essential but important for virulenceNot fully characterizedModerate
  • Rational Drug Design Approaches:

    • Structure-based design of inhibitors that selectively target the metal-binding pocket of fungal GPI12.

    • Development of transition-state analogs that mimic the de-N-acetylation reaction.

    • Design of allosteric inhibitors that bind to fungal-specific regulatory sites.

    • Exploitation of differences in substrate recognition between fungal and mammalian enzymes.

  • Phenotypic Consequences of Inhibition:

    • In C. albicans, disruption of GPI12 function leads to cell wall defects and filamentation defects .

    • These phenotypes suggest that GPI12 inhibitors could reduce fungal virulence and increase susceptibility to existing antifungals that target the cell wall.

    • The filamentation defects associated with GPI12 inhibition in C. albicans correlate with upregulation of the HOG1 pathway, suggesting potential combination therapy approaches .

The essential nature of GPI12 across pathogenic fungi, combined with structural and biochemical differences from the human homolog, positions this enzyme as a promising target for novel antifungal development strategies .

What can cross-species analysis of GPI12 loss-of-function reveal about evolutionary adaptations in the GPI biosynthesis pathway?

Cross-species analysis of GPI12 loss-of-function phenotypes provides profound insights into the evolutionary adaptations of the GPI biosynthesis pathway. This comparative approach reveals species-specific dependencies and functional divergence:

SpeciesGPI12 Loss PhenotypeGPI Pathway AdaptationEvolutionary Implication
S. cerevisiaeLethalNo apparent alternative pathwayStrong purifying selection on GPI pathway
C. albicansLethal; cell wall and filamentation defectsHOG1 pathway upregulationIntegration with stress response pathways
L. majorViable but reduced infectivityAlternative mechanisms may existAdaptation to parasitic lifestyle
L. mexicanaGPI8 null mutants viable and infectiousPotentially complete bypass of classical pathwayRadical evolutionary adaptation
T. cruziUnable to obtain GPI3/GPI10 single allele knockoutPossibly increased gene dosage requirementUnique pathway regulation

This cross-species analysis reveals that while the basic chemistry of GPI biosynthesis is conserved, organisms have evolved diverse regulatory mechanisms and pathway dependencies tailored to their ecological niches and cellular requirements . The variability in essentiality suggests that the GPI pathway has been subject to different evolutionary forces across lineages, potentially reflecting adaptation to distinct environmental pressures and cellular architectures.

How can structural knowledge of S. cerevisiae GPI12 inform the development of selective inhibitors against pathogenic fungal homologs?

Structural knowledge of S. cerevisiae GPI12 provides a foundation for the rational design of selective antifungal agents targeting pathogenic fungal homologs. This strategy leverages the essential nature of GPI12 in fungi while exploiting structural differences from mammalian homologs:

  • Structure-Based Drug Design Strategy:

    • Homology modeling of pathogenic fungal GPI12 enzymes using S. cerevisiae GPI12 as a template.

    • Identification of conserved catalytic residues across fungal species that differ from mammalian PIG-L.

    • Virtual screening of compound libraries against in silico models to identify potential inhibitors.

    • Fragment-based approaches targeting the active site or allosteric regulatory sites.

  • Exploiting Metal-Binding Site Differences:

    • The preference of fungal GPI12 for Mn²⁺ and Ni²⁺ versus the mammalian preference for Zn²⁺ provides a basis for selectivity .

    • Design of metal-chelating inhibitors that preferentially interact with the fungal enzyme's metal coordination geometry.

    • Development of compounds that disrupt the interaction between divalent cations and the conserved HXXH motif identified in C. albicans GPI12 .

  • Substrate Analog Development:

    • Design of non-hydrolyzable GlcNAc-PI analogs that competitively inhibit fungal GPI12.

    • Modification of the substrate's lipid portion to enhance specificity for fungal over mammalian enzymes.

    • Exploitation of differences in substrate binding pockets identified through structural analysis.

  • Allosteric Inhibition Approach:

    • Identification of fungal-specific regulatory sites distant from the active site.

    • Development of compounds that stabilize inactive conformations of the enzyme.

    • Targeting the N- and C-terminal regions, which are important for CaGpi12 function but may differ from mammalian homologs .

  • Validation Pipeline for Candidate Inhibitors:

    • In vitro enzymatic assays with purified proteins from multiple fungal species and human PIG-L.

    • Cellular assays measuring GPI-anchored protein expression in fungal and mammalian cells.

    • Assessment of growth inhibition in fungal pathogens versus mammalian cell toxicity.

    • Structural validation of binding mode through crystallography or other biophysical techniques.

  • Synergistic Inhibition Strategies:

    • Identification of compounds that synergize with existing antifungals by targeting GPI12.

    • Combination approaches targeting multiple steps in the GPI biosynthesis pathway.

    • Exploitation of the relationship between GPI12 inhibition and HOG1 pathway upregulation observed in C. albicans .

The essential nature of GPI12 in pathogenic fungi, combined with structural differences from mammalian homologs, makes this enzyme an attractive target for antifungal development. Sophisticated structure-based approaches can leverage these differences to create inhibitors with high fungal selectivity and broad-spectrum activity against multiple pathogenic species .

What experimental methods can assess the potential of GPI12 as a biomarker for fungal infections or antifungal resistance?

Evaluating GPI12's potential as a biomarker for fungal infections or antifungal resistance requires a multi-faceted experimental approach spanning molecular, cellular, and clinical investigations:

  • Detection of GPI12 Expression in Clinical Samples:

    • Development of highly specific antibodies against conserved fungal GPI12 epitopes.

    • Quantitative PCR assays targeting GPI12 mRNA in clinical specimens.

    • Mass spectrometry-based proteomics to detect GPI12 protein in patient samples.

    • Evaluation of sensitivity and specificity across different sample types (blood, tissue, BAL fluid).

  • Correlation with Infection Status and Disease Progression:

    • Longitudinal studies measuring GPI12 levels during infection establishment, progression, and treatment.

    • Assessment of GPI12 expression levels in relation to fungal burden.

    • Comparison of GPI12 detection with conventional diagnostic methods (culture, histopathology, β-D-glucan testing).

    • Determination of whether GPI12 levels correlate with clinical outcomes or treatment response.

  • Investigation of GPI12 Mutations in Resistant Strains:

    • Whole-genome sequencing of drug-resistant clinical isolates to identify GPI12 variants.

    • Site-directed mutagenesis to introduce identified mutations into reference strains.

    • Phenotypic characterization of mutant strains for altered drug susceptibility.

    • Biochemical analysis of mutant GPI12 enzymes for altered activity or regulation.

  • Assessment of GPI12 Activity as a Functional Biomarker:

    • Development of activity-based probes that specifically label active GPI12.

    • Comparison of enzyme activity levels between susceptible and resistant isolates.

    • Correlation of enzyme activity with minimum inhibitory concentrations of antifungals.

    • Evaluation of GPI12 activity as a predictor of treatment failure.

  • GPI-Anchored Protein Profile Analysis:

    • Comparative proteomics of GPI-anchored proteins in drug-susceptible versus resistant strains.

    • Assessment of whether alterations in GPI12 function correlate with changes in the GPI-anchored proteome.

    • Identification of specific GPI-anchored proteins whose expression changes could serve as surrogate markers.

  • Immunological Response Evaluation:

    • Detection of anti-GPI12 antibodies in patient sera as indirect evidence of infection.

    • Assessment of T-cell responses to GPI12 epitopes in patients with active infection.

    • Correlation of immune responses with infection severity and clinical outcomes.

  • Clinical Validation Studies:

    • Prospective cohort studies in high-risk patients to assess the predictive value of GPI12 as a biomarker.

    • Comparison of GPI12 detection with established biomarkers like galactomannan or β-D-glucan.

    • Assessment of whether GPI12 detection can identify infections earlier than conventional methods.

    • Evaluation of GPI12 testing for monitoring treatment efficacy and predicting relapse.

The combined data from these experimental approaches would provide a comprehensive assessment of GPI12's utility as a biomarker for fungal infections and drug resistance, potentially leading to improved diagnostic tools and personalized treatment strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.