Recombinant Saccharomyces cerevisiae N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, mitochondrial (FMP30)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae N-acyl-phosphatidylethanolamine-hydrolyzing Phospholipase D, Mitochondrial (FMP30)

Saccharomyces cerevisiae N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, mitochondrial (FMP30) is a protein encoded by the FMP30 gene in yeast and is homologous to mammalian N-acylPE (NAPE)-specific phospholipase Ds (NAPE-PLDs) . FMP30 is located in the inner mitochondrial membrane and has a large domain exposed to the intermembrane space .

Function and Mechanism

FMP30 is involved in the maintenance of cardiolipin (CL) levels, particularly under conditions where phosphatidylethanolamine (PE) levels are reduced in the mitochondria .

FMP30 is essential for UPS1-independent and low-level PE-enhanced CL accumulation . It functions cooperatively with Mdm31 and Mdm32 in a pathway that is critical for CL synthesis when mitochondrial PE is reduced and Ups1 is defective . Fmp30 physically interacts with both Mdm31 and Mdm32, further supporting their cooperative action in the same pathway .

Role in Cardiolipin Accumulation

FMP30 plays a significant role in cardiolipin (CL) accumulation, especially when PE levels are low . In ups1∆ cells, deletion of FMP30 is synthetically lethal, indicating its importance in maintaining CL levels under these conditions . Studies using a tetracycline-regulatable promoter (tet-FMP30) have shown that repression of FMP30 expression significantly reduces CL accumulation in various mutant cells, such as ups1∆ups2∆, ups1∆psd1∆, and ups1∆cho1∆ .

Experiments have demonstrated that while the CL level in tet-FMP30 cells is not significantly affected by doxycycline (Dox), the CL levels in ups2∆, psd1∆, and cho1∆ cells carrying tet-FMP30 are decreased by Dox addition . This suggests that mutations like ups2∆, psd1∆, and cho1∆ shift the FMP30-dependent pathway for CL accumulation from a minor to a major one .

Interactions with Mdm31 and Mdm32

Fmp30 interacts physically with Mdm31 and Mdm32, indicating that these three proteins function together in the maintenance of CL levels . Immunoprecipitation experiments have confirmed that Fmp30-3xHA co-immunoprecipitates with both FLAG-Mdm31 and FLAG-Mdm32 . These interactions are crucial for CL synthesis under conditions of reduced mitochondrial PE and defective Ups1 function .

Clinical Significance

FMP30 is being explored in the context of fecal microbiota transplantation (FMT) for treating relapsing-remitting multiple sclerosis (RR-MS) . A clinical trial (NCT03594487) is underway to evaluate the efficacy of FMT of FMP30 donor stool in RR-MS patients .

Trial IdentifierConditionPhaseEnrollmentIntervention
NCT03594487Relapsing-Remitting Multiple Sclerosis1b30Fecal Microbiota Transplantation (FMT) of FMP30

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FMP30; YPL103C; N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, mitochondrial; NAPE-PLD; NAPE-hydrolyzing phospholipase D; Found in mitochondrial proteome protein 30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
40-468
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FMP30
Target Protein Sequence
ASQKTRPIQKCSRKYARILLLSVLVPYTGYAFYVSLATVKQIDLRNEMCQRLEENNNEVT YKGSLLKYSPLEVLGRFENPFEEYRIQTVFEFFANRVFELFERNRGGIPRDVHQMNKLMP VHKPTWGPNLVDVDPAEETALPLECKVLDELHIPTAVEENEGSKCPVYNTWLGQSCNYTV YNGLRILTDPLFSDFLIHKTLGPKRITQMPSQITEVPKPDIILVSHNHPDHLDLESLEYW SGKDSPLWIVPKGMKSYMTSNGCDNVLELSWWETLQVKKNNEIYHISATPAMHWSGRSLL DTNKSLWCSFLLTHHGNPILFHAGDTGYVKDLFVRIKERFGKGCKLALLPCGQYCPEWHQ KPRHINPQEVLKIMKDLEARNVLGVHWGTFVLSGEYFLEPKEKLEMLAEWGGFKDRCYCP ELGKTECFD
Uniprot No.

Target Background

Function
This recombinant *Saccharomyces cerevisiae* N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, mitochondrial (FMP30), hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs).
Gene References Into Functions
  1. Studies have shown that Fmp30p is involved in maintaining mitochondrial morphology and is necessary for normal cardiolipin accumulation when mitochondrial phosphatidylethanolamine synthesis is impaired. PMID: 21306442
Database Links

KEGG: sce:YPL103C

STRING: 4932.YPL103C

Protein Families
NAPE-PLD family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is FMP30 and what is its primary function in Saccharomyces cerevisiae?

FMP30 encodes a mitochondrial inner membrane protein in the yeast Saccharomyces cerevisiae that plays a crucial role in maintaining mitochondrial morphology and phospholipid homeostasis. The protein exhibits strong homology with mammalian N-acylPE-specific phospholipase Ds (NAPE-PLDs) and is primarily involved in the metabolism of cardiolipin (CL), a critical phospholipid for mitochondrial function . The protein contains a large domain exposed to the intermembrane space, which is essential for its enzymatic activity and interactions with other mitochondrial proteins . FMP30 functions as part of a complex network maintaining phospholipid balance, particularly when cells face challenges in phosphatidylethanolamine (PE) synthesis pathways .

How does FMP30 relate to cardiolipin metabolism?

FMP30 plays a significant role in cardiolipin metabolism, particularly when the normal phospholipid synthesis pathways are compromised. While FMP30 deletion alone causes only a slight decrease in cardiolipin levels, its importance becomes evident under specific genetic conditions:

Genetic BackgroundCardiolipin Level (% of wild-type)FMP30 Requirement
Wild-type100%Minor
fmp30ΔSlightly decreasedN/A
psd1ΔReducedMajor
ups1Δ~20%Minor
ups1Δpsd1ΔEnhanced compared to ups1ΔEssential

FMP30 is particularly critical for maintaining cardiolipin levels when mitochondrial PE synthesis is compromised (as in psd1Δ cells) . Most significantly, FMP30 becomes essential for the UPS1-independent and low-level PE-enhanced accumulation of cardiolipin that occurs in ups1Δpsd1Δ double mutant cells . This indicates that FMP30 participates in an alternative pathway for cardiolipin synthesis that becomes activated under specific stress conditions.

What phenotypes are observed when FMP30 is deleted?

Deletion of FMP30 results in several observable phenotypes with varying severity depending on the genetic background:

  • Mitochondrial morphology defects: FMP30 deletion causes abnormalities in mitochondrial morphology, suggesting its role in maintaining the structural integrity of mitochondria .

  • Phospholipid composition changes: While fmp30Δ cells grown under normal conditions show only slightly decreased cardiolipin levels, significant reductions occur when combined with other mutations affecting phospholipid metabolism .

  • Synthetic growth defects: Most notably, fmp30Δ exhibits a synthetic growth defect with psd1Δ, which encodes a phosphatidylserine decarboxylase responsible for mitochondrial PE synthesis . Even more severe, deletion of FMP30 is synthetically lethal with the ups1Δ mutation .

  • Enhanced phenotypes in double mutants: When FMP30 expression is repressed in strains already carrying mutations in phospholipid metabolism genes (ups2Δ, psd1Δ, or cho1Δ), cardiolipin levels decrease by approximately 40-60%, highlighting FMP30's importance in these compromised backgrounds .

What is the localization of FMP30 within yeast cells?

FMP30 is specifically localized to the mitochondrial inner membrane (MIM) with a distinctive topology. The protein has a large domain that extends into the intermembrane space (IMS) between the inner and outer mitochondrial membranes . This spatial arrangement is critical for its function in phospholipid metabolism, as it allows FMP30 to interact with other components of the phospholipid biosynthetic machinery located at different mitochondrial compartments.

The intermembrane space localization of its catalytic domain enables FMP30 to physically interact with other mitochondrial proteins, particularly Mdm31 and Mdm32, which are also involved in cardiolipin synthesis pathways . Immunoprecipitation experiments have confirmed these physical interactions, with stronger binding observed between FMP30 and Mdm32 compared to Mdm31 . The mitochondrial inner membrane localization allows FMP30 to directly influence phospholipid composition at the site most enriched in cardiolipin.

What are the genetic interactions of FMP30 and how do they inform our understanding of its function?

FMP30 exhibits complex genetic interactions that provide valuable insights into its function in phospholipid metabolism and mitochondrial morphology:

  • Interaction with PSD1: Deletion of FMP30 results in a synthetic growth defect with psd1Δ (encoding phosphatidylserine decarboxylase), indicating functional overlap or convergence in phospholipid biosynthetic pathways . This interaction suggests FMP30 becomes particularly important when the mitochondrial PE synthesis pathway is compromised.

  • Synthetic lethality with UPS1: FMP30 deletion is synthetically lethal with ups1Δ, which encodes a protein involved in phosphatidic acid transfer for cardiolipin synthesis . This demonstrates that FMP30 functions in a parallel pathway essential for cell viability when the primary UPS1-dependent pathway is absent.

  • Interactions with mitochondrial morphology genes: FMP30 genetically interacts with at least seven mitochondrial morphology genes, reinforcing its role in maintaining mitochondrial structure . These interactions highlight the interconnection between phospholipid composition and mitochondrial morphology.

  • Functional relationship with UPS2 and CHO1: The enhanced cardiolipin accumulation in ups1Δ cells is dependent not only on UPS2 deletion but also on mutations in PE and PS synthesis pathways (PSD1 and CHO1), with FMP30 being required for this enhanced accumulation . This indicates FMP30's involvement in alternative cardiolipin synthesis pathways activated under specific conditions.

These genetic interactions collectively suggest that FMP30 functions in a compensatory pathway for cardiolipin synthesis that becomes essential when conventional pathways are compromised, particularly under conditions of reduced mitochondrial PE levels.

How does FMP30 cooperate with Mdm31 and Mdm32 in cardiolipin biosynthesis?

FMP30 cooperates with Mdm31 and Mdm32 in a specialized pathway for cardiolipin biosynthesis that becomes critical under specific conditions. This cooperation is evidenced by both genetic and biochemical data:

Physical Interaction Evidence:
Immunoprecipitation experiments have demonstrated direct physical interactions between these proteins. FMP30 co-immunoprecipitates with both FLAG-Mdm31 and FLAG-Mdm32, with stronger interaction observed with Mdm32 . These physical associations were confirmed through multiple experimental approaches:

  • Immunoprecipitation using native expression levels of tagged proteins

  • Validation using overexpressed Fmp30-HA with FLAG-tagged Mdm31 or Mdm32

  • Control experiments confirming specificity (other inner membrane proteins like Tim23 did not co-immunoprecipitate)

Functional Cooperation Evidence:
Depletion of any one of these three factors (Fmp30, Mdm31, or Mdm32) almost completely prevents cardiolipin synthesis under mitochondrial-PE-reduced and Ups1-defective conditions . This indicates that all three proteins function together in the same pathway rather than in parallel pathways.

The cooperation between these proteins becomes particularly important in specific genetic backgrounds:

  • In ups1Δups2Δ double mutants (defective in phospholipid transport proteins)

  • In ups1Δpsd1Δ cells (defective in both phospholipid transport and PE synthesis)

  • In ups1Δcho1Δ cells (defective in both phospholipid transport and PS synthesis)

This cooperative function appears to represent an alternative pathway for cardiolipin synthesis that operates independently of the Ups1-mediated pathway and becomes activated particularly when mitochondrial PE levels are reduced .

What experimental approaches can be used to study FMP30 function in mitochondrial morphology?

Multiple experimental approaches can be employed to investigate FMP30's role in mitochondrial morphology:

1. Fluorescence Microscopy Techniques:

  • Mitochondrial-targeted fluorescent proteins (e.g., mitochondrial matrix-targeted GFP) to visualize morphological changes in wild-type versus fmp30Δ cells

  • Live-cell time-lapse imaging to capture dynamic changes in mitochondrial structure

  • Super-resolution microscopy for detailed visualization of structural abnormalities

2. Genetic Manipulation Strategies:

  • Tetracycline-regulatable promoter systems (TET-off) to control FMP30 expression levels and timing, as demonstrated in previous studies

  • Creation of point mutations in specific domains to identify regions crucial for morphology maintenance

  • Epistasis analysis with known mitochondrial morphology genes to place FMP30 in existing pathways

3. Biochemical and Biophysical Approaches:

  • Phospholipid analysis using 32P-labeling to correlate morphological changes with alterations in membrane composition

  • Electron microscopy to examine detailed ultrastructural changes in mitochondria

  • Membrane fluidity measurements to assess biophysical properties of mitochondrial membranes

4. Protein Interaction Studies:

  • Immunoprecipitation to identify additional binding partners beyond Mdm31 and Mdm32

  • Proximity labeling techniques (BioID, APEX) to map the spatial proteome surrounding FMP30

  • Blue native PAGE to identify native protein complexes containing FMP30

5. Functional Assays:

  • Respiration measurements to correlate morphological changes with functional outcomes

  • Membrane potential assessments using fluorescent dyes

  • ROS production measurements to evaluate consequences of morphological abnormalities

By combining these approaches, researchers can comprehensively characterize FMP30's role in maintaining mitochondrial morphology and connect structural changes to underlying molecular mechanisms and functional consequences.

How does FMP30 function in conditions of reduced phosphatidylethanolamine levels?

FMP30's function becomes particularly critical under conditions of reduced phosphatidylethanolamine (PE) levels in mitochondria. Several experimental observations illuminate this specialized role:

  • Enhanced Requirement in PE-Deficient Backgrounds: While FMP30 deletion alone causes only a slight decrease in cardiolipin (CL) levels, its importance dramatically increases in genetic backgrounds with reduced PE synthesis. In psd1Δ cells (deficient in mitochondrial PE synthesis), FMP30 is required for maintaining normal CL levels .

  • Role in Alternative CL Synthesis Pathway: Under conditions of both reduced PE and UPS1 deficiency, FMP30 becomes essential for an alternative pathway of CL synthesis. Specifically, in ups1Δpsd1Δ, ups1Δups2Δ, and ups1Δcho1Δ cells, depletion of FMP30 causes a severe reduction in CL levels .

  • Quantitative Impact on CL Levels: Experimental data from 32P-labeling studies show that:

    • In normal cells, FMP30 depletion has minimal impact on CL levels

    • In ups1Δ cells, FMP30 depletion does not significantly further decrease the already reduced CL levels

    • In contrast, in ups1Δpsd1Δ cells, FMP30 depletion causes a dramatic reduction in the enhanced CL accumulation observed in these cells

  • Cooperation with Mdm31/Mdm32: Under low PE conditions, FMP30 works cooperatively with Mdm31 and Mdm32 to maintain CL levels through a UPS1-independent pathway . This cooperation appears to be specifically activated or enhanced when mitochondrial PE levels are reduced.

The underlying mechanism may involve alterations in membrane properties due to reduced PE levels, which could activate or enhance FMP30's enzymatic activity. Alternatively, reduced PE might alter the substrate availability or specificity for FMP30, potentially shifting its function toward enhanced CL synthesis to compensate for the altered membrane composition.

What structural and functional homology exists between yeast FMP30 and mammalian N-acylPE-specific phospholipase Ds?

Yeast FMP30 exhibits significant structural and functional homology with mammalian N-acylPE-specific phospholipase Ds (NAPE-PLDs), suggesting evolutionary conservation of key enzymatic mechanisms:

Structural Homology:

Functional Parallels:

  • Both enzyme families are involved in specialized phospholipid metabolism pathways.

  • Mammalian NAPE-PLDs hydrolyze N-acyl-phosphatidylethanolamines to produce bioactive N-acylethanolamines and phosphatidic acid.

  • While the natural substrates for yeast FMP30 have not been definitively established, its involvement in phospholipid metabolism, particularly under conditions of altered PE levels, suggests functional similarity.

Evolutionary Implications:

  • The conservation of this enzyme family from yeast to mammals indicates the fundamental importance of specialized phospholipid metabolism pathways.

  • Yeast FMP30 may represent an ancestral form of the enzyme that was later adapted in mammals for signaling functions.

  • Studying FMP30 in yeast provides a simplified model system to understand the core enzymatic mechanisms without the complexity of mammalian signaling networks.

Despite these similarities, it's important to note that the physiological contexts differ significantly. In mammals, NAPE-PLDs are involved in generating signaling lipids like anandamide, while in yeast, FMP30 appears to function primarily in maintaining mitochondrial phospholipid homeostasis, particularly in relation to cardiolipin levels under specific stress conditions .

What biochemical assays can be used to measure FMP30 enzymatic activity?

Several biochemical assays can be employed to measure FMP30 enzymatic activity, each with specific advantages for investigating different aspects of its function:

1. Radioisotope-Based Assays:

  • 32P-Phospholipid Analysis: As demonstrated in previous studies, metabolic labeling of yeast cells with [32P]Pi followed by phospholipid extraction and thin-layer chromatography allows quantification of various phospholipid species, including cardiolipin . This approach can assess FMP30's impact on phospholipid levels in vivo.

  • In Vitro Enzymatic Assays with Radiolabeled Substrates: Purified FMP30 can be incubated with radiolabeled synthetic substrates (potential N-acyl-PE derivatives) to measure product formation through scintillation counting or autoradiography.

2. Fluorescence-Based Assays:

  • FRET-Based Substrate Analogs: Synthetic substrates containing fluorophore pairs that undergo FRET changes upon enzymatic cleavage can provide real-time measurement of enzymatic activity.

  • Environmentally-Sensitive Fluorescent Probes: Probes that change fluorescence properties upon interaction with specific lipid species can monitor product formation.

3. Mass Spectrometry Approaches:

  • Untargeted Lipidomics: LC-MS/MS analysis of lipid extracts from wild-type versus fmp30Δ cells can identify accumulating substrates or depleted products.

  • Targeted Multiple Reaction Monitoring (MRM): Quantification of specific lipid species that may be substrates or products of FMP30 activity.

  • In Vitro Activity Assays with MS Detection: Incubation of purified FMP30 with potential substrates followed by mass spectrometry analysis of reaction products.

4. Expression Systems for Enzymatic Characterization:

  • Heterologous Expression: Recombinant production of FMP30 in E. coli or insect cells for purification and in vitro characterization.

  • Tetracycline-Controlled Expression: As used in previous studies , regulated expression systems in yeast to correlate enzyme levels with activity.

5. Coupled Enzyme Assays:

  • Phosphate Release Measurement: If FMP30 activity releases phosphate, coupling to a phosphate detection system (e.g., malachite green assay) could provide a colorimetric readout.

  • pH-Sensitive Indicators: If hydrolysis by FMP30 generates charged products, pH-sensitive dyes could detect local pH changes.

When designing these assays, researchers should consider:

  • The membrane association of FMP30 may require detergent solubilization or reconstitution into liposomes

  • The potential requirement for specific lipid environments that mimic the mitochondrial inner membrane

  • The possibility that FMP30 may require specific cofactors or interacting partners (like Mdm31 or Mdm32) for full activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.