Recombinant Saccharomyces cerevisiae N-glycosylation protein EOS1 (EOS1)

Shipped with Ice Packs
In Stock

Description

N-Glycosylation Regulation

EOS1 participates in the endoplasmic reticulum (ER) N-glycosylation pathway, which involves:

  1. Precursor glycan assembly: Dolichol-PP-linked GlcNAc₂Man₉Glc₃ formation .

  2. Glycan attachment: Transfer of Man₉GlcNAc₂ to asparagine residues via oligosaccharyltransferase (OST) .

  3. Glycan maturation: Trimming and extension in the Golgi (e.g., mannose addition) .

Experimental evidence:

  • Δeos1 strains exhibit reduced KAR2 transcription (ER stress-inducible gene) and impaired N-glycosylation of invertase and carboxypeptidase Y under tunicamycin-induced stress .

  • EOS1 deletion enhances tunicamycin tolerance, suggesting a role in ER quality control .

Oxidative Stress Sensitivity

EOS1 deletion confers hypersensitivity to oxidative stress, indicating a protective role in cellular redox balance. This phenotype is linked to its interaction with spindle checkpoint genes (e.g., BUB3, MAD1) .

Impact on Protein Secretion

ApplicationOutcomeSource
Heterologous protein productionDeletion of mannosyltransferases (e.g., OCH1, MNN9) improves secretion yields but does not directly involve EOS1.
ER stress response engineeringOverexpression of IRE1 (UPR regulator) enhances recombinant protein secretion, suggesting crosstalk with EOS1 pathways.

Interaction Networks

PartnerInteraction TypeConfidence ScoreSource
YLR111WPredicted functional partner0.697

Note: YLR111W is annotated as a dubious ORF with low functional confidence .

Glycosylation Engineering

EOS1’s role in N-glycosylation makes it a candidate for:

  • Humanized glycosylation: Yeast strains with engineered glycosylation pathways (e.g., SEC59 mutants) show dysregulated lipid metabolism and ER stress, highlighting EOS1’s potential in optimizing recombinant protein production .

  • Protein quality control: Δeos1 strains exhibit reduced ERAD efficiency (ER-associated degradation), impacting protein folding .

Key Challenges

  • Hypermannosylation: Native yeast glycosylation produces non-human glycans (Man₉GlcNAc₂), necessitating engineering for mammalian-like glycosylation .

  • ER stress sensitivity: Deletion of EOS1 or related genes (e.g., IRE1) disrupts UPR, limiting recombinant protein yields .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
EOS1; YNL080C; N2327; N-glycosylation protein EOS1; ER-localized and oxidants sensitive protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
EOS1
Target Protein Sequence
MTWILSTGMGPHEDKYAKHERATFKKTYSSMKTLSLNHLTAKQHMLMALCRDISLLPPLT YIFTSLRKAWRVSMRTSITLYEPQSLRDAFTYFWQKLNSAYDNNSSFEGASQKAVNGDGK DSLLLSALTTARASEYLLCSLWCLVSLYLSYAILDSLMVRWIVKYSTVAAILRMFSMSLI IVTLELLLLSSLSPELDYFLHTWILISCVLTAVYIWQSYLTSDLRYIRNQEGEVQEDTNV PEETEDYEDGEDDADEDSHVVVADESTVDVPSNDSLSDNSDGGLFPVNRPSVSHSQSPKR PKKYPKKAFNFTTKRTIDLYKITVLCVVPVGLASFITMLGLLRNLFIQRLDVEQLERILH EMHPPA
Uniprot No.

Target Background

Function
EOS1 plays a crucial role in oxidative stress resistance and N-glycosylation processes.
Database Links

KEGG: sce:YNL080C

STRING: 4932.YNL080C

Protein Families
EOS1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is EOS1 and where is it localized in Saccharomyces cerevisiae?

EOS1 (YNL080c) is a non-essential gene in Saccharomyces cerevisiae that plays a significant role in stress response, particularly oxidative stress tolerance. Through immunofluorescence microscopic and cellular fractionation analyses, researchers have determined that the Eos1 protein localizes in the endoplasmic reticulum (ER) membrane of yeast cells . This localization is consistent with its proposed function in protein modification pathways, specifically N-glycosylation processes. The protein's membrane localization suggests it may function as part of the protein quality control machinery within the ER, potentially interfacing with other components of the glycosylation pathway.

What phenotypes are associated with EOS1 deletion in yeast?

Deletion of the EOS1 gene (Δeos1) results in several distinct phenotypes:

  • Oxidative stress sensitivity: The most prominent phenotype is increased sensitivity to hydrogen peroxide, indicating a critical role in oxidative stress tolerance .

  • High-sucrose sensitivity: Δeos1 strains show reduced growth under high-sucrose conditions, suggesting involvement in osmotic stress response pathways .

  • Freeze-thaw stress sensitivity: The mutant strain exhibits cross-sensitivity to freeze-thaw stress, further supporting its role in general stress tolerance mechanisms .

  • Enhanced tunicamycin tolerance: Interestingly, EOS1 deletion enhances tolerance to tunicamycin, an inhibitor of N-glycosylation .

These phenotypes collectively suggest that EOS1 functions at the intersection of stress response and protein modification pathways in yeast cells.

How is EOS1 connected to N-glycosylation processes?

EOS1 appears to be integrally involved in N-glycosylation of cellular proteins, as evidenced by several experimental observations:

  • When exposed to tunicamycin (an N-glycosylation inhibitor), Δeos1 cells show decreased transcription of KAR2, an ER stress-inducible gene, compared to wild-type strains .

  • The inhibition of N-glycosylation of carboxypeptidase Y and reduction in invertase activity typically caused by tunicamycin is significantly decreased in Δeos1 strains .

  • The enhanced tunicamycin tolerance in Δeos1 strains further suggests that the normal function of EOS1 may be linked to glycosylation-dependent quality control mechanisms in the ER .

These findings collectively suggest that EOS1 plays a role in the N-glycosylation pathway, potentially affecting the glycosylation status of various cellular proteins involved in stress response.

What are the recommended methods for studying EOS1 localization?

To study EOS1 localization effectively, researchers should consider a multi-faceted approach:

  • Immunofluorescence microscopy: Using antibodies specific to Eos1 or epitope-tagged versions of the protein, combined with ER markers such as Kar2/BiP, to visualize its subcellular localization .

  • Cellular fractionation: Separate cellular components through differential centrifugation, followed by Western blot analysis to detect Eos1 in specific fractions .

  • GFP fusion proteins: Creating C-terminal or N-terminal GFP-tagged Eos1 constructs for live-cell imaging, being mindful that tagging may affect protein function.

  • Co-localization studies: Using confocal microscopy with markers for different ER domains to determine precise localization within the ER membrane.

For optimal results, researchers should verify localization using at least two independent methods and include appropriate controls to account for potential artifacts introduced by tagging or fixation procedures.

How can researchers effectively generate and validate EOS1 deletion strains?

Generation and validation of EOS1 deletion strains require careful experimental design:

Generation Protocol:

  • Design deletion cassettes containing a selectable marker (e.g., KanMX4) flanked by 40-50bp sequences homologous to regions upstream and downstream of EOS1.

  • Transform the deletion cassette into wild-type yeast (e.g., BY4741) using the lithium acetate method .

  • Select transformants on appropriate selective media.

Validation Steps:

  • PCR verification: Design primers that anneal outside the targeted deletion region and within the selection marker to confirm correct integration.

  • RT-PCR: Verify absence of EOS1 transcript.

  • Phenotypic confirmation: Test for expected phenotypes, particularly:

    • Sensitivity to 1 mM hydrogen peroxide on SD plates

    • Growth inhibition under high-sucrose conditions (>0.9 M)

    • Enhanced growth on tunicamycin-containing media

Control Considerations:

  • Include the isogenic wild-type strain in all experiments.

  • Consider complementation tests by reintroducing EOS1 to confirm phenotype rescue.

  • Use multiple independently generated deletion strains to rule out secondary mutations.

What experimental design is recommended for studying EOS1's role in oxidative stress response?

A comprehensive experimental design for studying EOS1's role in oxidative stress response should include:

  • Growth assays under oxidative stress conditions:

    • Spot assays with serial dilutions of wild-type and Δeos1 strains on media containing various concentrations of H₂O₂ (0.5 mM - 2 mM)

    • Growth curve analysis in liquid media with sub-lethal H₂O₂ concentrations

    • Cross-stress tests with other oxidants (e.g., menadione, paraquat) to determine specificity

  • Molecular response measurements:

    • ROS detection using fluorescent probes like DCFH-DA or DHE

    • Antioxidant enzyme activity assays (catalase, superoxide dismutase)

    • Lipid peroxidation levels as markers of oxidative damage

  • Transcriptional response analysis:

    • RT-qPCR for known oxidative stress response genes

    • RNA-seq comparison between wild-type and Δeos1 under basal and stress conditions

    • ChIP analysis to identify any direct transcriptional effects

  • Genetic interaction studies:

    • Double deletion strains with known oxidative stress response genes

    • Suppressor screens similar to those that identified IZH2

    • Overexpression of EOS1 to determine if enhanced stress resistance occurs

StrainControl Growth0.5 mM H₂O₂1 mM H₂O₂2 mM H₂O₂
Wild-type++++++++++
Δeos1+++++++-
Δeos1 + EOS1++++++++++
Δeos1 + IZH2++++++++++

This experimental framework enables comprehensive characterization of EOS1's role in oxidative stress response pathways.

How does the suppression of Δeos1 phenotype by IZH2 overexpression work mechanistically?

The multicopy suppression of oxidant-sensitive eos1 mutation by IZH2 represents a complex genetic interaction requiring in-depth investigation. Based on current research, several potential mechanistic explanations can be proposed:

  • Functional redundancy: IZH2 may have overlapping functions with EOS1 in certain aspects of N-glycosylation or stress response, becoming evident only when overexpressed.

  • Compensatory pathways: IZH2 overexpression might activate alternative stress response pathways that compensate for the loss of EOS1-dependent protection mechanisms.

  • Direct interaction with EOS1 interactors: IZH2 protein may interact with the same protein complexes or substrates as EOS1, potentially restoring some of the lost functionality.

To investigate this suppression mechanism, researchers should consider:

  • Transcriptome analysis comparing Δeos1, wild-type, and Δeos1+IZH2 overexpression strains under oxidative stress conditions

  • Proteomic analysis to identify potential common interactors

  • Metabolomic profiling to determine if IZH2 overexpression restores metabolic imbalances caused by EOS1 deletion

  • Detailed analysis of N-glycosylation patterns in these strains to determine if IZH2 restores normal glycosylation

The suppression screening methodology used in previous research identified IZH2 from approximately 20,000 transformants, suggesting this suppression is specific rather than a general stress response effect .

What is the relationship between EOS1's role in N-glycosylation and oxidative stress tolerance?

The connection between EOS1's involvement in N-glycosylation and its role in oxidative stress tolerance represents a fascinating research question that spans multiple cellular processes. Several hypothetical models could explain this relationship:

  • Glycosylation of stress response proteins: EOS1 may be required for proper N-glycosylation of specific proteins involved in oxidative stress defense. Improper glycosylation could lead to misfolding, degradation, or dysfunction of these proteins.

  • ER stress and ROS production: Alterations in N-glycosylation patterns in Δeos1 strains may trigger ER stress, which is known to increase ROS production, potentially overwhelming cellular antioxidant defenses.

  • Altered protein quality control: N-glycosylation plays a crucial role in protein quality control in the ER. Disruption of this process in Δeos1 strains may lead to accumulation of misfolded proteins, triggering cellular stress responses.

To investigate these hypotheses, researchers could:

  • Identify specific glycoproteins affected by EOS1 deletion using glycoproteomic approaches

  • Measure ER stress markers in wild-type and Δeos1 strains under normal and oxidative stress conditions

  • Determine if antioxidant protein activities are affected by altered glycosylation in Δeos1 strains

  • Create mutations in EOS1 that specifically affect either glycosylation function or stress response to dissect these roles

The observation that Δeos1 exhibits higher sensitivity to oxidative stress than to high-sucrose stress suggests that its primary role may be in oxidative stress protection, with glycosylation functions potentially serving as a mechanism for this protection .

How does EOS1 deletion affect the unfolded protein response (UPR) and ER stress pathways?

The relationship between EOS1 and the unfolded protein response (UPR) appears paradoxical based on current research findings:

  • When exposed to tunicamycin (an N-glycosylation inhibitor that typically induces ER stress), Δeos1 strains show lower transcription levels of KAR2 (an ER stress-inducible gene) compared to wild-type strains .

  • Despite this reduced UPR activation, Δeos1 strains exhibit enhanced tolerance to tunicamycin, which is counterintuitive since reduced UPR would typically make cells more sensitive to ER stress .

This paradox suggests several possible mechanisms:

  • Alternative stress response activation: EOS1 deletion may activate alternative stress response pathways that compensate for reduced UPR activation.

  • Altered ER quality control thresholds: The absence of EOS1 may change the threshold for recognizing misfolded proteins, potentially reducing the perceived ER stress despite the presence of unfolded proteins.

  • Reduced dependency on N-glycosylation: Δeos1 cells may have adapted to function with altered glycosylation patterns, making them less dependent on this process.

To investigate these possibilities, researchers should consider:

  • Comprehensive transcriptome analysis of UPR target genes beyond KAR2

  • Direct measurement of unfolded protein levels in the ER

  • Analysis of HAC1 splicing (a key UPR regulator) in response to various stressors

  • Genetic interaction studies with key UPR components (IRE1, HAC1)

ConditionWild-type KAR2 expressionΔeos1 KAR2 expressionWild-type growthΔeos1 growth
ControlBaselineBaselineNormalNormal
TunicamycinHighly inducedModerately inducedInhibitedLess inhibited
H₂O₂Moderately induced?Slightly inhibitedStrongly inhibited
Combined stressors????

These research directions would help clarify the complex relationship between EOS1, ER stress, and oxidative stress response pathways.

What are the recommended approaches for identifying EOS1-dependent glycoproteins?

To comprehensively identify glycoproteins dependent on EOS1 for proper N-glycosylation, researchers should employ multiple complementary approaches:

  • Glycoproteomic analysis:

    • Enrich for glycoproteins using lectin affinity chromatography

    • Compare glycoprotein profiles between wild-type and Δeos1 strains using mass spectrometry

    • Focus on quantitative differences in glycosylation patterns rather than just presence/absence

    • Consider using SILAC or TMT labeling for quantitative comparison

  • Targeted analysis of known glycoproteins:

    • Analyze migration patterns of known glycoproteins (e.g., carboxypeptidase Y) by Western blot

    • Use Endo H or PNGase F digestion to confirm N-glycosylation changes

    • Employ specific antibodies that recognize glycosylated epitopes

  • Metabolic labeling approaches:

    • Use radioactive mannose or other sugar precursors to track newly synthesized glycoproteins

    • Compare incorporation rates between wild-type and Δeos1 strains

    • Combine with immunoprecipitation to focus on specific candidate proteins

  • Functional screening:

    • Test activity of known glycoenzymes (e.g., invertase) as functional readouts of proper glycosylation

    • Expand testing to other enzymes that depend on glycosylation for function

    • Correlate activity changes with alterations in glycosylation patterns

The comparative approach should include appropriate controls including:

  • Wild-type strain (positive control)

  • Known glycosylation-defective strains (e.g., mutations in OST complex)

  • Δeos1 complemented with functional EOS1 (rescue control)

How can researchers effectively investigate EOS1 protein interactions and complex formation?

Investigating EOS1 protein interactions requires specialized approaches given its membrane localization in the ER:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Generate functional epitope-tagged EOS1 constructs (e.g., TAP-tag, FLAG-tag)

    • Use mild detergents (e.g., digitonin, DDM) to solubilize membrane proteins while preserving interactions

    • Perform tandem affinity purification followed by mass spectrometry

    • Compare results with control purifications to identify specific interactors

  • Proximity-based labeling approaches:

    • Fuse EOS1 to BioID or APEX2 enzymes

    • Allow in vivo biotinylation of proteins in close proximity to EOS1

    • Purify biotinylated proteins and identify by mass spectrometry

    • These methods are particularly valuable for membrane proteins as they don't require preservation of interactions during purification

  • Yeast two-hybrid membrane system variants:

    • Use split-ubiquitin or MYTH (membrane yeast two-hybrid) systems designed for membrane proteins

    • Screen against cDNA libraries or candidate interactors

    • Validate positive interactions with secondary methods

  • Co-immunoprecipitation validation:

    • Generate antibodies against EOS1 or use epitope-tagged versions

    • Perform co-IP experiments with candidate interactors

    • Use crosslinking agents to stabilize transient interactions

  • Genetic interaction mapping:

    • Perform synthetic genetic array (SGA) analysis with Δeos1

    • Identify genes that show synthetic lethality or synthetic rescue

    • Focus on genes involved in N-glycosylation and stress response pathways

When reporting interaction data, the following table format is recommended:

ProteinDetection MethodConfidence ScoreKnown FunctionAffected by Oxidative Stress?
Protein XAP-MSHighER quality controlYes
Protein YBioIDMediumN-glycosylationNo
Protein ZMYTHLowOxidative stress responseYes

What experimental design is optimal for studying the transcriptional effects of EOS1 deletion under different stress conditions?

An optimal experimental design for investigating transcriptional changes in Δeos1 strains should comprehensively capture responses across different stress conditions and time points:

Experimental Design Matrix:

  • Strains to include:

    • Wild-type (BY4741)

    • Δeos1

    • Δeos1 complemented with EOS1

    • Δeos1 with IZH2 overexpression

  • Stress conditions to test:

    • Control (no stress)

    • Oxidative stress (0.5mM and 1mM H₂O₂)

    • ER stress (tunicamycin, DTT)

    • Combination of oxidative and ER stress

    • High osmotic stress (1M sucrose)

  • Time points for sampling:

    • Immediate response (15-30 minutes)

    • Early adaptation (1-2 hours)

    • Late adaptation (4-6 hours)

  • Analytical approaches:

    • RNA-seq for global transcriptome analysis

    • RT-qPCR validation of key genes

    • ChIP-seq for key transcription factors (e.g., Yap1, Msn2/4, Hac1)

Key controls and considerations:

  • Include biological triplicates for all conditions

  • Normalize growth conditions precisely before applying stress

  • Verify stress application by measuring markers of each stress (e.g., oxidized proteins, HAC1 splicing)

  • Use spike-in controls for normalization across samples

Analysis approach:

  • Identify differentially expressed genes in each condition

  • Perform pathway enrichment analysis

  • Compare stress-specific and shared responses

  • Construct gene regulatory networks

  • Validate key nodes with targeted experiments

Expected outcomes and interpretation:

Gene CategoryExpected in WTExpected in Δeos1Interpretation if observed
Oxidative stress responseUpregulated under H₂O₂Impaired upregulationDirect role of EOS1 in oxidative stress signaling
UPR targetsUpregulated with tunicamycinReduced upregulationEOS1 required for normal UPR activation
General stress responseUpregulated under all stressesSimilar to WTEOS1 not involved in general stress pathways
N-glycosylation machineryMinimal changeCompensatory upregulationCellular attempt to overcome glycosylation defects

This comprehensive approach will allow researchers to dissect the specific transcriptional networks affected by EOS1 deletion and how these networks respond to different stressors.

What are the most promising approaches for elucidating the precise biochemical function of EOS1?

To determine the precise biochemical function of EOS1, researchers should pursue these promising approaches:

  • Structural biology:

    • Resolve the membrane protein structure through cryo-EM or X-ray crystallography

    • Identify potential active sites or binding domains

    • Perform in silico docking studies to predict substrate interactions

  • Domain-specific mutagenesis:

    • Create a series of point mutations in conserved residues

    • Perform systematic truncation analysis to identify functional domains

    • Test each mutant for complementation of phenotypes (oxidative stress sensitivity, tunicamycin resistance)

  • In vitro biochemical assays:

    • Develop reconstitution systems with purified components

    • Test for enzymatic activities related to glycosylation (glycosyltransferase, chaperone, quality control)

    • Assess direct binding to candidate substrates or partners

  • Comparative genomics:

    • Identify EOS1 homologs across fungal species

    • Correlate sequence conservation with functional conservation

    • Perform heterologous complementation tests

  • Metabolite profiling:

    • Compare N-glycan structures in wild-type and Δeos1 strains

    • Analyze lipid profiles, particularly those involved in ER membrane function

    • Investigate metabolic changes in glycosylation precursor pathways

The most definitive approach would likely combine structural insights with targeted biochemical assays based on phenotypic and interaction data.

How might researchers investigate potential clinical or biotechnological applications of EOS1 research?

While maintaining focus on academic research rather than commercial applications, several promising research directions could bridge fundamental EOS1 research to potential future applications:

  • Improved protein production systems:

    • Investigate if modulating EOS1 function can enhance production of recombinant glycoproteins in yeast

    • Test whether EOS1 manipulation can reduce protein aggregation or improve secretion efficiency

    • Develop experimental systems to optimize glycosylation patterns for specific applications

  • Antifungal drug development research:

    • Determine if the stress sensitivity in Δeos1 strains could be exploited to enhance antifungal efficacy

    • Investigate if EOS1 function is conserved in pathogenic fungi

    • Develop assays to identify compounds that specifically target EOS1-dependent processes

  • Model system for glycosylation disorders:

    • Establish whether EOS1-dependent processes have homologs in higher eukaryotes

    • Investigate if yeast EOS1 research can provide insights into congenital disorders of glycosylation

    • Develop screening platforms for compounds that rescue glycosylation defects

  • Stress resistance in industrial strains:

    • Explore how modulating EOS1 and its partners affects stress tolerance relevant to industrial fermentation

    • Investigate genetic backgrounds where EOS1 overexpression might enhance stress resistance

    • Develop experimental designs to test strain performance under industrial conditions

These research directions maintain academic rigor while establishing groundwork for potential translational applications, focusing on methodology development rather than commercial processes.

What interdisciplinary approaches might yield new insights into EOS1 function and regulation?

Interdisciplinary approaches can provide novel perspectives on EOS1 function, potentially revealing unexpected connections:

  • Systems biology:

    • Construct comprehensive models of N-glycosylation and stress response networks

    • Perform flux analysis to determine how EOS1 affects metabolic pathways

    • Use machine learning to identify patterns in large-scale datasets that might reveal EOS1 functions

  • Evolutionary biology:

    • Trace the evolutionary history of EOS1 across fungal lineages

    • Investigate co-evolution with interacting partners

    • Determine if EOS1 function has been conserved or repurposed during evolution

  • Biophysics:

    • Examine how EOS1 affects ER membrane properties

    • Investigate protein dynamics using advanced imaging techniques (FRET, FRAP)

    • Apply single-molecule approaches to study EOS1 function in vitro

  • Computational biology:

    • Deploy molecular dynamics simulations to study EOS1 protein structure

    • Use network analysis to position EOS1 within cellular stress response systems

    • Apply text mining to extract relationships from literature that might not be immediately apparent

  • Chemical biology:

    • Develop small molecule probes that target EOS1 or its partners

    • Use activity-based protein profiling to identify functional relationships

    • Apply metabolic labeling strategies to track EOS1-dependent processes

By integrating these diverse approaches, researchers can develop a more comprehensive understanding of EOS1 function beyond what traditional molecular biology approaches might reveal.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.