Recombinant Saccharomyces cerevisiae Non-homologous end-joining protein 1 (NEJ1)

What is the structural composition of NEJ1 and how does it function in NHEJ?

NEJ1 is a 342-amino acid protein in Saccharomyces cerevisiae with a full sequence of: MDSELKGQQLSDAEWCVKKINGEGNCLLLFLPMSSPTTIVMIVLVSLERLVPYVFKLSQTQLSQQCQSQGFTDSISLNLIKLKLMDILQAPQEINQIGLVDSNLVFSFDVSADITVSINS VPSHVTKDMFYMILQSLCMLLLKLVNLSTQYHYVQRDILNEKQKCLDFLLISLRDLDGGSKVISS QWAPENSKNYESLQQCTDDDIIKKLLHKGKFQHQEFLADSLKTLLSLRNKFQDVSRFEESGELNKKERVRFPAVNHFYNDDFELQADPTNEARPNSRGKIKPKTDFKPKSR ESSTSQLRLENFSESEATPEKTKSSSSLVEEYPQKKRKFGKVRIKN .

Despite having no known enzymatic activity, NEJ1 functions by stimulating the ligase activity of the Dnl4-Lif1 complex through direct physical interaction with Lif1, promoting Dnl4 deadenylation that is necessary for efficient end-joining. Cells lacking NEJ1 show equivalent defects in end-joining as ku70Δ and dnl4Δ mutant cells, highlighting its essential role in the NHEJ pathway .

How does NEJ1 differ from other NHEJ factors in evolutionarily diverse organisms?

NEJ1 represents a unique regulatory component of the NHEJ machinery in S. cerevisiae that has not yet been identified in other organisms. While yeast shares many core NHEJ components with mammals (including KU70, KU80, DNA ligase IV homologs), S. cerevisiae lacks clear homologs of DNA-PKcs and ARTEMIS, which are important components in mammalian NHEJ . Additionally, S. cerevisiae requires the Mre11/Rad50/Xrs2 complex for NHEJ, unlike Schizosaccharomyces pombe or mammals . This makes NEJ1 particularly interesting as a specialized yeast-specific factor in NHEJ regulation, suggesting potential evolutionary divergence in NHEJ mechanism regulation.

What is the standard methodology for producing recombinant NEJ1 protein for in vitro studies?

The standard approach involves expressing full-length NEJ1 (1-342 amino acids) with an N-terminal His tag in E. coli expression systems . The protein is typically purified to >90% homogeneity as determined by SDS-PAGE. For storage and handling:

• The protein is lyophilized in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

• Recommended reconstitution is in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Addition of 5-50% glycerol (final concentration) is advised for long-term storage at -20°C/-80°C

• Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week

How does NEJ1 regulate the choice between NHEJ and homologous recombination at DSB sites?

NEJ1 plays a critical role in determining repair pathway choice through multiple mechanisms:

• End protection and Ku stability: NEJ1 enhances Ku stability at unresected DNA ends, preventing initiation of 5' resection that would direct repair toward homologous recombination (HR) .

• Sae2 interaction: NEJ1 inhibits the interaction between Sae2 and the Mre11-Rad50-Xrs2 (MRX) complex, thus reducing Sae2 localization to DSBs. This interaction specifically inhibits the initiation of DNA resection, representing a function distinct from its role in end-joining repair .

• Dna2-Sgs1 inhibition: NEJ1 prevents unregulated resection near the break site (0.15 kb) that would otherwise be mediated by the Dna2-Sgs1 nuclease/helicase complex . In nej1Δ mutants, hyper-resection is observed that depends on Dna2-Sgs1 but not Exo1.

• End-bridging function: NEJ1 participates in end-bridging that restrains broken DNA ends, reducing the frequency of genomic deletions at break sites. This function shows an epistatic relationship with SAE2 .

These mechanisms collectively demonstrate that NEJ1's role extends beyond canonical NHEJ function to actively suppress HR pathway initiation.

What is the relationship between NEJ1 and RNA:DNA hybrid resolution at double-strand breaks?

Recent research has uncovered an unexpected connection between NEJ1 and RNA:DNA hybrids (RDHs) at DSB sites:

• In nej1Δ mutants, there is a marked decrease in RDH levels compared to wild-type or ku70Δ mutants, contrasting with the expectation that both NHEJ factors might affect RDHs similarly .

• This reduction in RDH levels is not due to altered transcription at DSBs, suggesting that the absence of NEJ1 enhances hybrid resolution through a mechanism distinct from RNaseH1 regulation .

• The deletion of NEJ1 reverses increased RDH levels in rnh201Δ mutants (deficient in RNase H2) to below wild-type levels .

• There appears to be an antagonistic relationship between NEJ1 and DNA2, where:

  • In nej1Δ mutants, hybrid levels are reduced to background levels

  • Dna2 recovery increases fivefold within 45 minutes post-DSB induction

  • This hybrid reduction is dependent on the nuclease activity of Dna2

  • The nuclease-deficient dna2-1 mutation reverses RDH loss in nej1Δ mutants

This suggests a model where NEJ1 and Dna2 have opposing effects on RDH accumulation at DSBs, with NEJ1 promoting RDH persistence and Dna2 nuclease activity resolving these structures when uninhibited.

How does the Sae2-NEJ1 interaction affect genetic outcomes and cell viability in the context of DSB repair?

The interaction between NEJ1 and Sae2 has significant consequences for genetic stability and cell viability:

• Suppression of synthetic lethality: Deletion of NEJ1 suppresses the synthetic lethality observed in sae2Δ sgs1Δ double mutants. Importantly, the viability of the resulting triple mutant (nej1Δ sae2Δ sgs1Δ) depends on Dna2 nuclease activity .

• Impact on Dna2 recruitment: NEJ1 inhibits Sae2-dependent recruitment of Dna2 to DSBs, and this inhibition occurs independently of Sgs1 . This represents a distinct mechanism from the previously established role of NEJ1 in preventing resection mediated by the Dna2-Sgs1 complex.

• End-bridging coordination: NEJ1 and SAE2 show an epistatic relationship for end-bridging, suggesting they function in the same pathway to restrain broken DNA ends and prevent genomic deletions .

This complex interplay demonstrates how NEJ1 coordinates with different factors to regulate not only repair pathway choice but also the downstream genetic consequences of repair outcomes.

What are the optimal experimental approaches to study NEJ1 function in DNA repair pathway choice?

Several complementary approaches have proven effective:

• Genetic mutant analysis: Generate and compare single, double, and triple mutants (nej1Δ, ku70Δ, sae2Δ, sgs1Δ, dna2-1, etc.) to establish epistatic relationships and genetic dependencies. Key phenotypes to measure include:

  • Efficiency of NHEJ repair

  • Extent of 5' resection

  • Cell survival following DSB induction

  • Frequency of genomic rearrangements

• DSB induction systems: The HO endonuclease system is widely used, allowing for controlled induction of a single DSB at a specific genomic location. Researchers typically:

  • Induce HO expression using a galactose-inducible promoter

  • Monitor DSB formation and repair over time

  • Measure resection at different distances from the break (e.g., 0.15 kb) at specific timepoints after HO induction (e.g., 6 hours)

• Protein-protein interaction studies:

  • Co-immunoprecipitation to detect physical interactions between NEJ1 and other factors (Lif1, Sae2)

  • Yeast two-hybrid assays to map interaction domains

  • In vitro binding assays with recombinant proteins

• Chromatin immunoprecipitation (ChIP):

  • Standard ChIP with crosslinking to detect stable factor recruitment

  • Non-crosslinking ChIP to detect more transient interactions (notably used to detect decreased Ku binding in nej1Δ mutants)

  • Monitor recruitment of NEJ1 and other factors to induced DSBs over time

How can researchers accurately measure and quantify 5' resection at DSBs to evaluate NEJ1 activity?

Accurate measurement of 5' resection is critical for understanding NEJ1 function. Researchers should consider these methodological approaches:

• qPCR-based resection assay:

  • Design primers at various distances from the break site (e.g., 0.15 kb, 1 kb)

  • Digest genomic DNA with restriction enzymes that only cut non-resected DNA

  • The ratio between digested and undigested DNA indicates resection extent

  • Compare resection kinetics between wild-type and mutant cells at multiple timepoints (0-180 minutes post-cutting)

• ChIP for resection factors:

  • Monitor recruitment of resection factors (Dna2, Sgs1, Exo1)

  • Correlate with the loss of NHEJ factors from the break site

  • Establish temporal dynamics of the repair pathway choice

• Direct detection of ssDNA:

  • BrdU incorporation and detection under non-denaturing conditions

  • ssDNA-specific antibodies

  • Southern blot analysis with strand-specific probes

This data demonstrates that NEJ1 and Ku function in an epistatic manner to prevent resection, as nej1Δ ku70Δ double mutants show resection patterns indistinguishable from ku70Δ single mutants .

What approaches can be used to study the role of NEJ1 in RNA:DNA hybrid regulation at DSBs?

To investigate NEJ1's role in RNA:DNA hybrid (RDH) regulation:

• DRIP (DNA-RNA Immunoprecipitation):

  • Use S9.6 antibody that specifically recognizes RNA:DNA hybrids

  • Compare RDH levels at DSBs in wild-type, nej1Δ, ku70Δ, and rnh201Δ backgrounds

  • Measure both abundance and persistence of RDHs over time after DSB induction

• Combined genetic approaches:

  • Create double mutants (nej1Δ rnh201Δ, nej1Δ dna2-1)

  • Measure RDH levels and resection rates

  • Compare to single mutants to establish genetic relationships

• Transcription analysis:

  • Monitor RNA polymerase activity and transcript levels near DSBs

  • Rule out transcriptional changes as the cause of altered RDH levels

• Factor recruitment dynamics:

  • Perform ChIP for Dna2 and other factors in different genetic backgrounds

  • Correlate with RDH levels and resection rates

Research has shown that in nej1Δ mutants, Dna2 recovery increases fivefold within 45 minutes post-DSB induction, coinciding with RDH reduction to background levels. This effect is reversed in the nuclease-deficient dna2-1 background, establishing a clear relationship between NEJ1, Dna2 nuclease activity, and RDH processing .

How can researchers address the technical challenges of working with recombinant NEJ1 protein in functional assays?

Working with recombinant NEJ1 presents several technical challenges:

• Protein stability issues:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Maintain working aliquots at 4°C for no more than one week

• Functional assay development:

  • Since NEJ1 has no enzymatic activity, design assays that measure its impact on partner proteins

  • For example, measure the stimulation of Dnl4-Lif1 ligase activity in the presence of recombinant NEJ1

  • Use EMSA (electrophoretic mobility shift assay) to assess DNA binding and end-bridging functions

• Partner protein co-purification:

  • Consider co-expressing NEJ1 with interaction partners (e.g., Lif1) for complex purification

  • Alternatively, perform in vitro reconstitution of complexes with individually purified components

  • Validate complex formation using size exclusion chromatography or native PAGE

• Physiological concentration considerations:

  • Determine the cellular concentration of NEJ1 in yeast

  • Use similar concentrations in in vitro assays to maintain physiological relevance

  • Consider the impact of cell-cycle or mating-type regulation on NEJ1 levels

How should researchers interpret apparently contradictory data regarding NEJ1 function in different experimental contexts?

Researchers may encounter seemingly contradictory data regarding NEJ1 function due to:

• Context-dependent activities:

  • NEJ1 has multiple functions (end-joining stimulation, resection inhibition, RDH regulation)

  • Different assays may capture different aspects of its functionality

  • Solution: Use multiple complementary assays and consider the specific context of each experiment

• Technical considerations in detection methods:

  • Standard ChIP shows similar Ku levels in wild-type and nej1Δ mutants

  • Non-crosslinking ChIP reveals decreased DNA-bound Ku in nej1Δ mutants

  • Solution: Be aware of how detection method limitations may affect data interpretation

• Genetic background effects:

  • NEJ1 function can be masked or modified by other mutations

  • For example, resection in nej1Δ ku70Δ double mutants is indistinguishable from ku70Δ single mutants, suggesting epistasis

  • Solution: Include appropriate genetic controls and perform epistasis analysis

• Temporal dynamics considerations:

  • NEJ1 effects may vary at different times after DSB formation

  • For example, in nej1Δ rnh201Δ mutants, resection increases similarly to nej1Δ from 0-90 minutes post-cutting

  • Solution: Perform time-course experiments to capture the dynamic nature of the repair process

What are the most promising areas for future research on NEJ1 function in genome stability?

Several promising research directions emerge from current understanding:

• Structural biology approaches:

  • Determine the crystal or cryo-EM structure of NEJ1 alone and in complex with Lif1

  • Identify functional domains and potential regulatory modifications

  • Use structure-guided mutagenesis to dissect specific functions

• Separation-of-function mutants:

  • Create NEJ1 variants that specifically disrupt interaction with Lif1 versus Sae2

  • Separate end-joining stimulation function from resection inhibition

  • Analyze the genetic consequences of each function independently

• Regulation by cell-cycle and mating type:

  • NHEJ is downregulated in meiosis-competent MATa/MATα diploid cells compared to haploids or diploids expressing only MATa or MATα

  • Investigate whether NEJ1 expression or activity is regulated by mating type or cell cycle

  • Identify potential regulatory factors that control NEJ1 function

• Potential therapeutic implications:

  • Explore whether manipulation of NEJ1-like functions in higher eukaryotes could enhance specific repair outcomes

  • Investigate whether NEJ1-inspired approaches could improve genome editing technologies

How might understanding NEJ1 function contribute to improved genome editing technologies?

NEJ1's role in regulating repair pathway choice suggests several potential applications:

• Enhanced NHEJ-mediated editing:

  • Developing factors inspired by NEJ1 that could enhance NHEJ efficiency in targeted genome editing

  • Potential application in CRISPR-Cas9 systems where NHEJ-mediated repair is desired

• Reduced off-target effects:

  • Understanding how NEJ1 influences repair pathway choice could help develop strategies to reduce unwanted genomic rearrangements during editing

  • Potential to enhance precision by controlling the balance between different repair pathways

• Cell-type specific editing optimization:

  • Different cell types rely on NHEJ versus HR to varying degrees

  • Knowledge of how NEJ1-like factors influence pathway choice could allow customization of editing approaches for specific cell types

• Temporal control of repair pathway:

  • Understanding the temporal dynamics of NEJ1 function could inspire approaches to temporarily shift repair pathway choice during editing procedures

  • This could maximize desired outcomes while minimizing unwanted genetic alterations