Recombinant Saccharomyces cerevisiae Nuclear control of ATPase protein 2 (NCA2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NCA2; YPR155C; Nuclear control of ATPase protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-616
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
NCA2
Target Protein Sequence
MIINRRILKSFEEISHSLEESLREVAFDSQQQLIQDVREENEELSRLQDQLQLIRSIVEK ICISIKTDNIDSYCSVPFDLLYNICKDIADPSSFEDGDLQYLVSQAIFEYIILLCYYSVT NECVQGLPAVYEAEQYYKTVSDSILKSFLYCLQNSVSTIRLLSQTVLKDVNKKKLSHQKW SLKALSVDLLEKIRPRINKFMVIRNFRFVGLPKKPIEIASLVSDIPRGIVHERLDMVTQS SKYYTIKLGQLITEFDQQPEENGMFTEVHLPNYERRLKSLQDFFGLAMSDSNLLDVIRCS AKFHKDHPLRRFTKPSILTRYWPSILLCLLYGPSSVMSLWNSRYFIQDFIKTNVVDFAKG LILNWLWAPLKQVWSTVKHDEGSAISVTSQETLNSDMDSLTRMIVSFVVDNSDSTSNSPI DPILLSTKVEHGDLTEFMEIYETQLHHPIKNIATGGLVRSLLIQLQKTKVDGSMALNGID KMLKSQQLVFGVVALSPALVILYSSIVALKRFVKLGNVWSNEKRYREQISISLNNVERVL NYSKQGADADEEHLNQGLLVIEVSNLYKLGSFLIPRSRKKEWFRDVEELVDTNLDSGAHI NVVNRIYHVYGRFLIH
Uniprot No.

Target Background

Function
Involved in the mitochondrial expression of subunits 6 and 8 of the F0-F1 ATP synthase.
Database Links

KEGG: sce:YPR155C

STRING: 4932.YPR155C

Protein Families
NCA2 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Nuclear control of ATPase protein 2 (NCA2) and what is its function?

NCA2 (Nuclear control of ATPase protein 2) is a nuclear-encoded protein in Saccharomyces cerevisiae that plays a critical role in mitochondrial function. The protein is specifically involved in the biogenesis of the mitochondrial proton-translocating ATPase . NCA2 (also known as ATP22) is located in the inner membrane of mitochondria and is necessary for the expression of the F0 component of the ATPase complex .

The protein belongs to a group of at least a dozen nuclear gene products that are essential for proper mitochondrial ATPase biogenesis. While some proteins like ATP11, ATP12, and FMC1 are involved in assembly of the F1 ATPase subunits, NCA2 affects the expression of the F0 unit . The gene encoding NCA2 is found in the nuclear genome, highlighting the coordinated relationship between nuclear and mitochondrial genomes in eukaryotic cells.

What methods are used for recombinant expression of NCA2?

Recombinant expression of NCA2 can be achieved through several different host systems, each with specific advantages:

Expression HostAdvantagesCommon ApplicationsTypical Purity
E. coliHigh yield, cost-effective, rapidBasic biochemical studies, antibody production≥ 85-90%
S. cerevisiaeNative post-translational modificationsFunctional studies, protein-protein interaction analyses≥ 85%
BaculovirusHigher eukaryotic modificationsStructural studies, complex protein analyses≥ 85%
Mammalian CellMost authentic modificationsInteraction studies with mammalian proteins≥ 85%

For E. coli expression systems, the protocol typically involves:

  • Cloning the NCA2 gene into an expression vector with an appropriate tag (commonly His-tag)

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions (temperature, inducer concentration, duration)

  • Cell lysis and protein extraction

  • Purification via affinity chromatography using the incorporated tag

  • Final purification through size exclusion chromatography if needed

The expressed protein is typically formulated in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for stability . For long-term storage, it's recommended to add 5-50% glycerol (final concentration) and aliquot for storage at -20°C/-80°C to prevent repeated freeze-thaw cycles .

How can I validate the expression and purification of recombinant NCA2?

Validating recombinant NCA2 expression and purification involves several complementary techniques:

  • SDS-PAGE Analysis:

    • Used to confirm the presence of a band at the expected molecular weight

    • Purity is typically assessed to be ≥85-90% for research applications

    • Silver staining can be used for higher sensitivity detection

  • Western Blot Analysis:

    • Confirms protein identity using antibodies specific to NCA2 or to the fusion tag

    • Can be used to detect the protein in complex mixtures or cellular fractions

  • Mass Spectrometry:

    • Provides definitive identification through peptide mass fingerprinting

    • Can verify post-translational modifications and protein integrity

    • The Yeast Resource Center database contains mass spectrometry data for various yeast proteins that can serve as reference

  • Functional Assays:

    • Activity tests specific to ATPase regulation

    • Mitochondrial import assays to confirm proper localization

    • Complementation studies in NCA2-deficient yeast strains

For monitoring protein stability, researchers often perform thermal shift assays and analyze the protein after different storage durations to ensure consistency in experimental results.

What experimental approaches can be used to study NCA2 function in vivo?

Several sophisticated approaches can be employed to investigate NCA2 function in S. cerevisiae:

  • Gene Deletion and Complementation Studies:

    • Create NCA2 knockout strains using homologous recombination

    • Assess phenotypic effects on mitochondrial function and ATPase assembly

    • Perform complementation with wild-type or mutant NCA2 variants

    • Restriction enzyme-mediated integration (REMI) techniques can be used for efficient gene targeting

  • Fluorescence Microscopy:

    • Tag NCA2 with fluorescent proteins (GFP, mCherry) to track localization

    • Use the Yeast Resource Center database which includes fluorescence microscopy data showing protein localization patterns

    • Perform co-localization studies with other mitochondrial and ATPase components

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid assays to identify interaction partners

    • Co-immunoprecipitation to confirm direct interactions in native conditions

    • Proximity labeling approaches (BioID, APEX) to map the NCA2 interactome

  • High-resolution techniques for studying ATPase assembly:

    • Cryo-EM structural analysis of ATPase complexes with and without NCA2

    • Blue native PAGE to analyze assembly intermediates

  • Functional assessment of mitochondrial ATPase:

    • Oxygen consumption measurements

    • ATP synthesis and hydrolysis assays

    • Membrane potential measurements

How can CRISPR/Cas9 technologies be applied to investigate NCA2 function?

CRISPR/Cas9 technology has revolutionized genetic manipulation in yeast and can be particularly powerful for studying NCA2:

  • CRISPR-based Genome Editing Strategies for NCA2:

The pCut toolkit and other Cas9-based systems have been developed specifically for S. cerevisiae . For NCA2 studies, consider these approaches:

CRISPR ApplicationMethodologyKey Considerations
Gene KnockoutComplete deletion of NCA2Select gRNAs with minimal off-target effects
Point MutationsIntroduction of specific amino acid changesRequires careful design of repair templates
TaggingC or N-terminal fusion with reportersEnsure tag doesn't interfere with function
Promoter ReplacementModulating expression levelsConsider using inducible promoters like GAL1
Multiplex EditingSimultaneous modification of NCA2 and interacting partnersRequires optimization of gRNA efficiency
  • Marker-free Integration Approaches:

The EasyClone-MarkerFree Vector Set provides an efficient system for marker-free integration in S. cerevisiae . This approach:

  • Utilizes separate plasmids for gRNAs and Cas9 expression

  • Facilitates integration through Cas9/gRNA complexes

  • Eliminates the need for marker recycling steps

  • Allows for integration at multiple genomic loci

  • Expression Optimization Considerations:

When modifying NCA2 expression, genomic integration loci significantly impact expression efficiency. Research has shown that the P<sub>TEF2</sub> promoter, often used in these systems, can exhibit variable expression levels depending on the integration site .

What are the comparative functions of NCA2 across different yeast species?

NCA2 homologs exist across multiple yeast species with varying degrees of conservation:

Yeast SpeciesNCA2 HomologNotable DifferencesResearch Focus
Saccharomyces cerevisiaeNCA2/ATP22Well-characterized, 616aa proteinMitochondrial ATPase biogenesis
Schizosaccharomyces pombenca2"mitochondrial protein Nca2 (predicted)"Less characterized than S. cerevisiae
Ashbya gossypiiNCA2/AGOS_AFR321CAlso known as AFR321CpLimited functional studies

Comparative genomic approaches using databases like YEASTRACT+ can provide insights into the evolution and functional conservation of NCA2 across species. YEASTRACT+ integrates data from multiple yeast databases:

  • YEASTRACT (focused on S. cerevisiae)

  • PathoYeastract (focused on pathogenic Candida species)

  • NCYeastract (focused on non-conventional yeasts with biotechnological relevance)

  • CommunityYeastract (user-created databases for other yeast species)

While S. cerevisiae NCA2 is well-studied in relation to mitochondrial ATPase function, the roles of its homologs in other species may have evolved additional or divergent functions that warrant investigation.

How does NCA2 participate in ATPase assembly pathways?

NCA2/ATP22 is part of a complex network of nuclear-encoded proteins essential for mitochondrial ATPase assembly:

  • Position in the ATPase Assembly Pathway:

    • While proteins like ATP11, ATP12, and FMC1 are involved in assembly of the F1 ATPase subunits

    • NCA2 specifically affects the expression of the F0 unit of the ATPase

    • It functions alongside other nuclear genes that promote processing, stability, and translation of mRNAs for mitochondrially encoded subunits 6 and 9 of F0

  • Coordination with Other Assembly Factors:
    Studies in S. cerevisiae have identified multiple assembly pathways:

    • F1 assembly pathway (ATP11, ATP12, FMC1)

    • F0 assembly pathway (including NCA2/ATP22)

    • Integration pathways connecting F1 and F0 assembly

  • Experimental Approaches to Study Assembly:

    • Genetic screens using assembly-defective mutants

    • Pulse-chase experiments to track assembly intermediates

    • Cryo-EM structural analysis of assembly intermediates

    • Comparative studies with related proteins like the APC/C complex components, which have been extensively studied by cryo-EM

What bioinformatic approaches can help analyze NCA2 function?

Several bioinformatic methods can provide insights into NCA2 function:

  • Necessary Condition Analysis (NCA) for Functional Relationships:

The NCA methodology (unrelated to the protein name) can be applied to analyze essential relationships between NCA2 and other cellular components . This approach:

  • Identifies "necessary but not sufficient" relationships

  • Distinguishes between different types of causal relationships

  • Complements traditional correlation and regression analyses

NCA involves several analytical steps for data assessment :

StepPurposeMethodology
Make ScatterplotVisualize potential relationshipsPlot observations in X-Y coordinate system
Identify Empty SpaceDetect potential necessary conditionsLook for empty upper-left corner in plot
Draw Ceiling LineDefine necessary condition boundaryUse ceiling regression techniques
Quantify ParametersCalculate effect sizeMeasure ceiling zone, scope, accuracy
Evaluate Effect SizeAssess significanceCompare to established benchmarks
Formulate Necessary ConditionExpress relationship formally"X is necessary for Y" statements
  • Structural Prediction and Analysis:

    • Ab initio structure predictions using Rosetta methods

    • Domain parsing with the Ginzu algorithm

    • Protein-protein interaction interface predictions

    • The Yeast Resource Center database contains protein structure prediction data that might include NCA2 or related proteins

  • Transcriptional Regulation Analysis:
    The YEASTRACT+ database can provide insights into:

    • Transcription factors regulating NCA2 expression

    • Co-regulated genes that might function in related pathways

    • Comparative analysis across yeast species

How can advanced structural biology techniques inform NCA2 research?

Recent advances in structural biology offer powerful approaches to understand NCA2:

  • Cryo-EM for Complex Analysis:
    Similar to studies on the APC/C complex in S. cerevisiae , cryo-EM can:

    • Determine high-resolution structures of NCA2 in complex with ATPase components

    • Identify conformational changes during assembly processes

    • Reveal binding interfaces with other proteins

  • Chemically Expanded Antibody Libraries:
    Advanced approaches such as yeast-displayed chemically expanded antibody libraries can:

    • Generate specific binding reagents for NCA2 structural studies

    • Incorporate non-canonical amino acids for specialized detection purposes

    • Enable high-throughput screening for conformation-specific binders

  • Integrative Structural Biology:
    Combining multiple techniques provides comprehensive structural insights:

    • X-ray crystallography for high-resolution domains

    • NMR for dynamic regions

    • Cross-linking mass spectrometry for interaction maps

    • Molecular dynamics simulations to understand functional movements

What are the current gaps in NCA2 research and future directions?

Several important questions about NCA2 remain unanswered:

  • Detailed Mechanistic Understanding:

    • Precise role in facilitating F0 assembly

    • Structural changes during ATPase biogenesis

    • Potential involvement in non-mitochondrial processes

  • Regulatory Networks:

    • How NCA2 expression is regulated during different growth phases

    • Response to mitochondrial stress and energy demands

    • Post-translational modifications affecting activity

  • Comparative Biology:

    • Functional conservation across evolutionary distant species

    • Unique features in pathogenic vs. non-pathogenic yeasts

    • Potential as a therapeutic target in pathogenic fungi

  • Future Research Directions:

    • Integration of multi-omics data to understand NCA2 in cellular networks

    • Application of synthetic biology tools for engineered NCA2 variants

    • Development of small molecule modulators of NCA2 activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.