Recombinant Saccharomyces cerevisiae Nuclear envelope morphology protein 1 (NEM1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Nuclear Envelope Morphology protein 1 (NEM1) is a protein component of the Nem1-Spo7 complex, which functions as a phosphatase . This complex is crucial for regulating lipid metabolism within the cell . NEM1, acting as the catalytic subunit, dephosphorylates phosphatidic acid phosphohydrolase PAH1 .

NEM1-Spo7 Complex and Pah1 Regulation

The Nem1-Spo7 complex plays a vital role in regulating Pah1, a phosphatidate phosphatase that controls the distribution of phosphatidate into triacylglycerol and phospholipid synthesis . The Nem1-Spo7 complex recruits and dephosphorylates Pah1 at the nuclear/ER membrane, thereby stimulating Pah1's phosphatase activity . Nem1 and Spo7 are themselves subject to phosphorylation, adding complexity to the regulation of Pah1 function .

Regulation of NEM1 and Spo7

Both NEM1 and Spo7 are subject to phosphorylation, adding another layer of control to Pah1 PAP activity . Protein kinases A and C phosphorylate Nem1 and Spo7 . The phosphorylation sites in Nem1 and Spo7 are located in intrinsically disordered regions of the proteins .

Role in Lipid Metabolism

NEM1 influences lipid synthesis by controlling the activity of Pah1, which is a key enzyme in determining whether phosphatidate is directed towards triacylglycerol or phospholipid synthesis .

Functional Characterization of ScENT1

ScENT1 (formerly known as Function Unknown Now 26 or FUN26) is the only known ENT ortholog endogenously expressed in Saccharomyces cerevisiae . ScENT1 is a broadly selective, high affinity, nucleoside and nucleobase transporter, with positional sensitivities to modifications at the C(2′)- and C(5′)-positions of the ribose ring .

NEM1 in other organisms

The Saccharomyces cerevisiae NDI1 gene, which encodes the mitochondrial internal NADH dehydrogenase, can complement a complex I deficient strain in Caenorhabditis elegans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NEM1; YHR004C; Nuclear envelope morphology protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
NEM1
Target Protein Sequence
MNALKYFSNHLITTKKQKKINVEVTKNQDLLGPSKEVSNKYTSHSENDCVSEVDQQYDHS SSHLKESDQNQERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLWFVFT FPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVEDDLN ASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLFPKKL IPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRP YCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIK DLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPF LEAMRYSTDVRNILALKHGEKAFNIN
Uniprot No.

Target Background

Function

The catalytic component of the NEM1-SPO7 complex functions as a phosphatase, dephosphorylating phosphatidic acid phosphohydrolase PAH1. It is crucial for spherical nucleus formation and meiotic division. The NEM1-SPO7 phosphatase is essential for efficient mitophagy under prolonged respiration, as well as for reticulophagy and pexophagy.

Gene References Into Functions
  1. Nem1p regulates nuclear growth by controlling phospholipid biosynthesis and is required for normal nuclear envelope morphology and sporulation. PMID: 26316593
Database Links

KEGG: sce:YHR004C

STRING: 4932.YHR004C

Protein Families
Dullard family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein.

Q&A

What is the role of NEM1 in S. cerevisiae nuclear envelope maintenance?

NEM1 (Nuclear Envelope Morphology protein 1) is involved in nuclear membrane biogenesis and lipid metabolism regulation in yeast. It functions as part of a phosphatase complex that influences nuclear envelope morphology through modulation of phospholipid synthesis pathways. Proper nuclear envelope structure is critical for nuclear functions, similar to how other nuclear envelope proteins like Ndc1p maintain nuclear pore complex (NPC) and spindle pole body integrity . Methodologically, fluorescent microscopy techniques with tagged nuclear envelope markers are commonly used to assess NEM1's contribution to nuclear envelope maintenance.

How does NEM1 relate to other nuclear envelope proteins in yeast?

NEM1 functions within a network of proteins that collectively maintain nuclear envelope structure and function. Similar to proteins like Msc1, which faces the nuclear envelope lumen and impacts nuclear pore complex localization when depleted , NEM1 contributes to proper nuclear envelope organization. Research approaches to study these relationships typically involve co-immunoprecipitation, genetic interaction screens, and high-resolution microscopy to visualize protein localization patterns within the nuclear envelope.

What phenotypes are associated with NEM1 mutations or deletions?

Disruptions in NEM1 function lead to distinctive nuclear envelope abnormalities, including alterations in nuclear shape and size. These phenotypic changes can be systematically characterized using approaches similar to those used in genome-wide nuclear morphology screens that have identified factors affecting nuclear envelope and nucleolar morphology . Methodologically, researchers should employ both fluorescence microscopy of live cells and electron microscopy of fixed samples to fully characterize the spectrum of nuclear envelope defects.

How does NEM1 dysfunction affect nuclear pore complex organization?

NEM1 dysfunction can lead to abnormal distribution and function of nuclear pore complexes (NPCs). This is similar to phenotypes observed when nuclear envelope proteins like Msc1 are depleted, which leads to NPC mislocation . Research methodologies should include immunofluorescence microscopy using NPC marker proteins (such as Nup49p colocalizing with Ndc1p as described in the literature ), coupled with functional assays of nucleocytoplasmic transport to assess the consequences of these structural abnormalities.

What is the relationship between NEM1 and chromatin organization?

Nuclear envelope proteins play crucial roles in chromatin organization and gene silencing. Research has shown that nuclear morphology alterations are often associated with chromatin-silencing defects . For investigating NEM1's role in this process, methodological approaches should include chromatin immunoprecipitation (ChIP) to assess changes in heterochromatin marks, RNA-seq to measure expression of normally silenced genes, and fluorescence microscopy to visualize changes in chromatin distribution within the nucleus.

How can genomic approaches be used to identify NEM1 genetic interactions?

Systematic genetic interaction studies can reveal functional relationships between NEM1 and other genes. Methodologically, this can be approached using synthetic genetic array (SGA) analysis similar to the genomic screens used to identify factors involved in nuclear architecture . This approach involves creating double mutants combining NEM1 deletion with other gene deletions, followed by phenotypic analysis to identify enhancers or suppressors of NEM1-associated defects.

What mechanisms connect NEM1 function to DNA damage repair pathways?

The nuclear envelope plays important roles in DNA damage responses, as demonstrated by studies showing that nuclear envelope surveillance is required for DNA repair . To investigate NEM1's potential involvement in these processes, researchers should employ DNA damage assays in NEM1 mutant backgrounds, coupled with live-cell imaging to track repair factor recruitment and resolution of repair foci. Genetic epistasis experiments with known DNA repair genes would help position NEM1 within these pathways.

What imaging techniques are most effective for studying NEM1-associated nuclear envelope defects?

A combination of imaging approaches provides the most comprehensive characterization of NEM1-associated nuclear envelope abnormalities:

TechniqueApplicationAdvantagesLimitations
Fluorescence microscopyLive-cell tracking of nuclear envelope dynamicsNon-invasive, temporal informationLower resolution
Electron microscopyUltrastructural analysis of membrane defectsHighest resolutionFixed samples only
Super-resolution microscopyNanoscale organization of nuclear envelope componentsCombines molecular specificity with high resolutionTechnical complexity
3D tomographyComprehensive spatial analysis of nuclear envelope structureComplete 3D visualizationTime-consuming analysis

Researchers should consider employing multiple imaging modalities, similar to the approaches used in nuclear morphology screens that monitor nuclear pore complexes and nucleolar proteins fused with fluorescent markers .

How can protein-protein interactions of NEM1 be systematically characterized?

Comprehensive analysis of NEM1 protein interactions requires multiple complementary approaches:

MethodApplicationKey Considerations
Affinity purification-mass spectrometryIdentification of stable interaction partnersRequires careful optimization of purification conditions
Yeast two-hybrid screeningDetection of binary protein interactionsMay detect interactions not occurring in vivo
Proximity labeling (BioID)Identification of proximal proteins in native contextDistinguishes direct from indirect interactions
Co-immunoprecipitationValidation of specific interactionsRequires high-quality antibodies or tagged proteins

Studies of other nuclear envelope proteins like Ndc1p, which interacts with both nuclear pore complexes and spindle pole bodies , provide methodological frameworks for such analyses.

What approaches can distinguish between direct and indirect effects of NEM1 on nuclear envelope structure?

Distinguishing direct from indirect effects requires careful experimental design:

  • Acute protein depletion systems (e.g., auxin-inducible degron tagging of NEM1) to observe immediate consequences versus adaptive responses

  • Structure-function analysis using point mutations that disrupt specific NEM1 activities

  • In vitro reconstitution experiments with purified components

  • Temporal analysis of phenotype emergence after NEM1 disruption

This approach is conceptually similar to studies of nuclear envelope proteins like Msc1, where researchers determined that it faces the NE lumen and its depletion leads to specific consequences for nuclear organization .

How should microscopy data of nuclear envelope defects be quantitatively analyzed?

Robust quantitative analysis of nuclear envelope imaging requires:

  • Automated segmentation algorithms to delineate nuclear boundaries

  • Measurement of nuclear size, shape, and envelope intensity profiles

  • Statistical analysis comparing wild-type and mutant populations

  • Classification of phenotypic categories based on morphological features

Similar quantitative approaches have been used in genome-wide screens to identify genes affecting nuclear morphology, where nuclear pore complexes and nucleolar proteins were monitored using fluorescent markers in approximately 400 deletion mutants .

What computational approaches can predict the functional impact of NEM1 mutations?

Predictive computational analysis of NEM1 mutations can employ:

ApproachApplicationMethodological Considerations
Structural modelingPrediction of mutation effects on protein structureRequires structural data or reliable homology models
Evolutionary conservation analysisIdentification of functionally critical residuesIncorporates data from multiple species
Network-based predictionContextualizing mutations within interaction networksIntegrates multiple data types
Constraint-based metabolic modelingPrediction of systemic effects on cellular metabolismSimilar to approaches used for other S. cerevisiae phenotype predictions

How can multi-omics data be integrated to understand NEM1 function holistically?

Integration of multiple data types provides comprehensive insight:

  • Combine transcriptomics data to identify expression changes

  • Integrate proteomics to detect altered protein levels and modifications

  • Incorporate lipidomics to characterize membrane composition changes

  • Add interaction network data to contextualize molecular changes

This multi-layered approach allows researchers to connect molecular changes to phenotypic outcomes, similar to constraint-based analysis methods used to predict S. cerevisiae phenotypes from genome-scale metabolic network reconstructions .

How does NEM1 function relate to nuclear envelope repair mechanisms?

Recent research highlights connections between nuclear envelope maintenance and repair pathways. Studies show that nuclear envelope proteins like Msc1 work synergistically with the ESCRT-III complex in DNA damage repair, with depletion of Msc1 leading to similar nuclear pore complex mislocation phenotypes as ESCRT-III disruption . Methodologically, researchers investigating NEM1's potential role in these processes should employ live-cell imaging of repair dynamics, genetic interaction studies with known repair factors, and acute damage assays to distinguish maintenance from repair functions.

What evolutionary insights can be gained from comparative analysis of NEM1 across fungal species?

Evolutionary analysis provides context for NEM1 function:

  • Sequence conservation analysis across fungal lineages

  • Complementation studies using NEM1 orthologs from diverse species

  • Comparison of nuclear envelope architecture and organization across species

  • Correlation of NEM1 functional differences with species-specific nuclear envelope characteristics

This approach builds upon our understanding of conserved nuclear envelope functions, such as those studied for Ndc1p in maintaining nuclear pore complexes .

How might advanced gene editing approaches enhance NEM1 functional studies?

Emerging CRISPR-based technologies offer new experimental possibilities:

TechnologyApplication to NEM1 ResearchMethodological Advantage
Base editingIntroduction of precise point mutations without DNA breaksCreation of allelic series with graduated effects
CRISPRi/CRISPRaTunable repression or activation of NEM1 expressionAnalysis of dosage-dependent functions
CRISPR screeningGenome-wide identification of genetic interactionsSystematic functional genomics approach
Prime editingPrecise introduction of specific mutationsCreation of disease-relevant variants

These approaches could extend the systematic screening strategies previously used to identify nuclear morphology factors , allowing more nuanced manipulation of NEM1 function.

What are the key considerations for studying membrane proteins like NEM1?

Working with membrane proteins presents specific challenges:

  • Protein extraction and solubilization require specialized detergent conditions

  • Maintaining native conformation during purification is difficult but critical

  • Expression systems must support proper membrane integration

  • Functional assays must account for lipid environment effects

These considerations are similar to challenges encountered when studying other nuclear envelope membrane proteins like Ndc1p, which is integrated into both nuclear pore complexes and spindle pole bodies .

How can temporal dynamics of NEM1 activity be effectively monitored?

Capturing the dynamic aspects of NEM1 function requires:

  • Development of activity-based sensors that report on NEM1-dependent processes

  • Time-resolved imaging approaches to track nuclear envelope changes

  • Synchronized cell populations to observe cell cycle-dependent functions

  • Inducible expression or degradation systems for acute perturbations

Similar approaches would be valuable for understanding temporal aspects of nuclear envelope surveillance mechanisms that have been shown to be important for DNA damage repair .

What control experiments are essential when analyzing NEM1 phenotypes?

Robust experimental design requires appropriate controls:

Control TypePurposeImplementation
Genetic controlsConfirm specificity of NEM1-associated phenotypesInclude related gene deletions, complementation controls
Environmental controlsDistinguish condition-dependent phenotypesTest multiple growth conditions and stressors
Technical controlsMinimize artifacts in imaging or biochemical analysisInclude microscopy controls, extraction controls
Temporal controlsDistinguish immediate from adaptive responsesUse time-course experiments after perturbation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.