Recombinant Saccharomyces cerevisiae Nuclear fusion protein KAR5 (KAR5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KAR5; SCY_4236; Nuclear fusion protein KAR5; Karyogamy protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-504
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
KAR5
Target Protein Sequence
SELGKINNLLQGRLIYTDNSVATNVLESKFPFLKSTCVKDALKLFLPQCIANGLESIDAE TRVETAIKLSICEFQASGLGEIPENCMVDDLGSMMDCMFELESSSQWWTTYSGNYQRLSS ICYENLLPFEKEQILKLFLNITELYDSFGDDVDTKLNHLMFQMEQDSQNFLDDLARMFRN YDNELRNATESNRIILENDLSFFRNKVNDVLYETSEQLEVQIIEKNSQLMNEVDTVHHIM SDLADELAKNDIKSKINDLKDDSLNNLQDLVEMSNDVKEYYSRNNKLVNTELENFSMGLK KQLGGMSKDLSESQMEAIELLQGFNSILHDSLLPSMTDEIVPEMTNFKNTLLQEWTAITS TLNGDFALWNEEIFSTFNDISEKLNGTKKKLDDIEIRVSLVHKNVMTMMRVLDFMWKTSK MIIRCGYLAVKNKYYWLLCSVVWIWSKYRTSRVNVKMIPIKRYYQWAALLLSIYLGAKTG SLIDF
Uniprot No.

Target Background

Function
Essential for nuclear membrane fusion during karyogamy.
Protein Families
KAR5 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is the KAR5 protein and what cellular processes require it?

KAR5 is required for membrane fusion during karyogamy, the process of nuclear fusion during yeast mating in Saccharomyces cerevisiae. It is a nonessential gene, as deletion mutations are viable, but they produce a bilateral defect in the homotypic fusion of yeast nuclei . KAR5 encodes a novel protein that shares similarity with a protein in Schizosaccharomyces pombe that may play a similar role in nuclear fusion . Kar5p is specifically induced as part of the pheromone response pathway, indicating that this protein uniquely plays a specific role during mating in nuclear membrane fusion rather than general cellular processes .

How is KAR5 localized within the cell and what is its membrane topology?

Kar5p is a membrane protein with its soluble domain entirely contained within the lumen of the endoplasmic reticulum (ER)/nuclear envelope. In pheromone-treated cells, Kar5p localizes to the vicinity of the spindle pole body (SPB), which is the initial site of fusion between haploid nuclei during karyogamy . Importantly, split-GFP assays have demonstrated that Kar5p localizes to both the inner and outer nuclear envelope, which is critical for its function in membrane fusion . The protein contains transmembrane domains that anchor it in the nuclear envelope, with most of its functional domains positioned within the ER lumen .

What are the major functional domains of Kar5p and their roles?

Kar5p contains several key functional domains that contribute to its role in nuclear fusion:

  • Signal peptide (SP) - Required for protein stability

  • Conserved domain - Essential for SPB interaction and localization

  • Coiled-coil domains (Coil1 and Coil2) - Critical for fusion

  • Transmembrane domains (TM1 and TM2) - Essential for membrane anchoring and Prm3p recruitment

  • Conserved cysteine residues - Various roles including protein stability, SPB interaction, and membrane linkage

The specific functions of these domains have been extensively characterized through mutational analysis, as summarized in the following table:

Domain/MutationGFP ExpressionSPB EnrichmentPrm3p RecruitmentFusionFunction
KAR5 (WT)+++++
SP+/−Stability
Conserved+++/−SPB interaction
Coil1+++Fusion?
Coil2NDND?
TM1++/−+/−Prm3p recruitment
TM2++
C13A+/−++/−+/−Stability
C68A+++Envelope link
C91A++/−SPB interaction?
C141A++Prm3p recruitment?

Phenotype levels from highest to lowest are ++, +, +/−, and −. ND = no data

What are the most effective methods for expressing and purifying recombinant Kar5p?

For recombinant expression of Kar5p, E. coli-based systems have been successfully employed. Based on available data, the following approach is recommended:

  • Express the mature protein (amino acids 20-504) rather than the full-length protein that includes the signal peptide

  • Use an N-terminal His-tag for purification

  • Express in E. coli with appropriate optimization of temperature and induction conditions

  • Purify using affinity chromatography with Ni-NTA resins

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Post-purification handling is critical:

  • Lyophilization helps with long-term storage

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for aliquots intended for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles, with working aliquots best kept at 4°C for up to one week

How can researchers effectively generate and characterize KAR5 mutants?

To generate informative KAR5 mutants, researchers should consider:

  • Disruption alleles creation:

    • Use integration plasmids like pRS405 (LEU2-marked) or pRS406 (URA3-marked)

    • Design linearized plasmids that disrupt the KAR5 open reading frame when transformed

    • Select transformants on appropriate selective media (SC-Leu or SC-Ura)

    • Confirm disruption by testing complementation with CEN-based vectors bearing KAR5

  • Domain-specific mutants:

    • Target conserved domains, transmembrane regions, and cysteine residues

    • Create both deletion and point mutations

    • Verify expression levels via Western blot and/or quantitative microscopy

  • Fusion protein constructs:

    • Design GFP fusions carefully, considering lumenal localization challenges

    • When tagging Kar5p with GFP, use a third transmembrane domain from other homologs (e.g., Tht1p from S. pombe) to improve expression and localization

    • Quantify both total cellular GFP intensity and percent GFP adjacent to the SPB to assess intrinsic stability and SPB enrichment

What assays can be used to evaluate Kar5p's function in nuclear fusion?

Several complementary assays can be employed to assess Kar5p function:

  • Karyogamy efficiency assays:

    • Interrupted plate matings to assess the ability of mutants to rescue the karyogamy defect

    • Quantitative mating assays to measure the frequency of successful nuclear fusion

  • Localization studies:

    • Fluorescence microscopy with Kar5p-GFP fusions to assess proper localization to the SPB

    • Quantitative analysis of SPB enrichment

    • Split-GFP assays to determine membrane topology and localization to inner versus outer nuclear membranes

  • Protein-protein interaction assays:

    • Assess recruitment of Prm3p to the nuclear envelope

    • Co-immunoprecipitation to identify interaction partners

    • Yeast two-hybrid assays for protein interaction mapping

  • Ultrastructural analysis:

    • Electron microscopy to visualize nuclear envelope bridges and membrane dynamics

    • Assess the stage of arrest in nuclear fusion process (pre- or post-outer nuclear membrane fusion)

How does Kar5p coordinate inner and outer nuclear membrane fusion during karyogamy?

Kar5p plays multiple distinct roles in nuclear membrane fusion:

  • Membrane coupling: Kar5p appears to couple the inner and outer nuclear membranes near the SPB. This is evidenced by the increased spacing between inner and outer nuclear membranes in kar5 mutant zygotes where nuclei are pulled together . The C68A mutation in Kar5p disrupts this membrane coupling function while preserving localization and Prm3p recruitment .

  • Sequential membrane fusion: Nuclear fusion occurs in two sequential steps - first outer nuclear membrane (ONM) fusion followed by inner nuclear membrane (INM) fusion. Electron microscopy revealed that kar5 mutants arrest with expanded nuclear envelope bridges, suggesting Kar5p is required after ONM fusion to facilitate INM fusion .

  • Membrane bridge expansion: In approximately half of kar5 mutant zygotes, no membranous bridges between nuclei were observed, suggesting Kar5p initiates membrane fusion. In zygotes with membrane bridges, their narrow cross-section suggests Kar5p also plays a role in expanding the initial outer membrane fusion event .

  • Dual membrane localization: Split-GFP assays demonstrated that Kar5p localizes to both inner and outer nuclear envelopes, positioning it ideally to coordinate fusion of both membrane layers .

A model has been proposed wherein Mps3p anchors Kar5p on the INM at the half-bridge, acting as a seed for further Kar5p oligomerization. Kar5p proteins on opposite faces of the nuclear envelope may dimerize or oligomerize in trans to link the ONM and INMs, possibly through disulfide bonds between conserved cysteine residues .

What is the relationship between Kar5p and other karyogamy proteins?

Kar5p interacts functionally with several other karyogamy proteins:

  • Prm3p interaction:

    • Kar5p recruits Prm3p to the SPB, which is essential for ONM fusion

    • Reciprocally, Prm3p promotes Kar5p accumulation in the nuclear envelope

    • Several kar5 mutant proteins localize properly but fail to recruit Prm3p, demonstrating this as a distinct function

  • Mps3p dependency:

    • Kar5p localization to the SPB is dependent on the half-bridge protein Mps3p

    • The conserved domain of Kar5p is required for this SPB localization

  • SNARE proteins:

    • SNAREs (soluble N-ethylmaleimide–sensitive factor attachment protein receptors) work alongside Prm3p to mediate outer nuclear membrane fusion

    • Kar5p functions in conjunction with these proteins but has additional roles beyond ONM fusion

  • Kar2p and Kar8p:

    • These proteins are found within the lumen of the nuclear envelope along with Kar5p

    • They function together with Kar5p in the nuclear fusion process

The ordered assembly of these proteins at the nuclear envelope during mating is critical for successful karyogamy, with Kar5p playing central coordinating roles.

How does the mechanism of Kar5p function inform our understanding of membrane fusion more broadly?

Insights from Kar5p function expand our understanding of membrane fusion mechanisms:

  • Homotypic fusion regulation: Kar5p represents a specialized protein required for regulation and activation of homotypic membrane fusion, with potential implications for understanding similar processes in other systems .

  • Sequential fusion model: The two-step process of nuclear fusion (ONM followed by INM) provides a model for studying how complex membrane fusion events are coordinated, with different proteins specialized for each step .

  • Membrane coupling: The ability of Kar5p to link inner and outer nuclear membranes suggests a mechanism for ensuring coordinated fusion of adjacent membrane layers - a concept potentially relevant to other double-membrane fusion events .

  • Localized fusion control: Kar5p's localization to the SPB demonstrates how cells can spatially restrict membrane fusion events through protein localization, ensuring that fusion occurs only at appropriate sites .

  • Oligomerization in fusion mechanisms: The proposed model of Kar5p oligomerization both laterally within membranes and in trans between membranes suggests how protein assemblies can create the molecular architecture necessary for membrane approximation and fusion .

How can structural studies of Kar5p advance our understanding of membrane fusion mechanisms?

Structural analysis of Kar5p would provide significant insights:

  • Conserved domain architecture: The conserved domain required for SPB localization represents a critical functional element. Structural characterization would reveal how this domain interacts with Mps3p or other SPB components .

  • Coiled-coil interactions: The coiled-coil domains (particularly Coil1) are essential for fusion despite not being required for localization or Prm3p recruitment. Structural studies would help determine if these domains mediate protein-protein interactions or contribute to membrane deformation .

  • Transmembrane organization: Understanding the precise arrangement of Kar5p's transmembrane domains would clarify how it spans membranes and potentially contributes to creating fusion pores .

  • Disulfide bond arrangements: The conserved cysteine residues likely form disulfide bonds critical for function. Structural studies would reveal whether these bonds form within a single Kar5p molecule or mediate oligomerization .

  • Conformational changes: Determining if Kar5p undergoes conformational changes during fusion would help elucidate the energetics of membrane fusion and potential mechanisms for coupling protein conformational changes to membrane rearrangements .

What are the evolutionary implications of KAR5 conservation across yeast species?

KAR5 encodes a protein with similarity to proteins in other yeast species, including Schizosaccharomyces pombe, suggesting evolutionary conservation of nuclear fusion mechanisms :

  • Functional conservation: The similar roles played by Kar5p homologs across yeast species suggest strong selective pressure to maintain nuclear fusion mechanisms during evolution .

  • Structural variations: Comparison of Kar5p across species reveals both conserved and divergent features. For example, several homologs of Kar5p have a fourth hydrophobic domain (e.g., Tht1p from S. pombe) not present in S. cerevisiae Kar5p .

  • Species-specific adaptations: Differences in Kar5p structure between species may reflect adaptations to species-specific aspects of mating and nuclear fusion, providing insights into how fundamental cell biological processes evolve .

  • Conserved cellular machinery: The conservation of nuclear fusion mechanisms involving Kar5p highlights the deep evolutionary roots of membrane fusion machinery, potentially informing our understanding of related processes in higher eukaryotes .

How might understanding Kar5p function contribute to biotechnological applications?

Understanding Kar5p function could enable several biotechnological applications:

  • Controlled cell fusion: Manipulating Kar5p and related proteins might allow for more precise control of cell fusion events in laboratory settings, with applications in yeast genetics and strain development .

  • Membrane fusion engineering: Insights from Kar5p function could inform the design of synthetic membrane fusion systems for applications in drug delivery, cell engineering, or synthetic biology .

  • Expression system optimization: The challenges in expressing functional Kar5p highlight considerations for producing other membrane proteins, potentially informing improved recombinant protein production strategies .

  • Model system for membrane biology: The detailed understanding of Kar5p's role in nuclear membrane fusion provides a well-characterized model system for studying fundamental aspects of membrane biology applicable to diverse research contexts .

What are the key considerations for storage and handling of recombinant Kar5p?

For optimal results with recombinant Kar5p:

  • Storage conditions:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) for long-term storage

    • Default recommendation is 50% glycerol final concentration

  • Buffer considerations:

    • Tris/PBS-based buffer with 6% trehalose, pH 8.0 provides optimal stability

    • Avoid repeated pH changes or exposure to extreme temperatures

What mutational strategies provide the most insight into Kar5p structure-function relationships?

Based on extensive characterization of Kar5p mutants, the following approaches are most informative:

  • Cysteine mutagenesis: Targeted mutation of conserved cysteine residues (particularly C13, C56, C68, C91, C105, C116, and C141) reveals distinct functional roles in stability, SPB interaction, envelope linkage, and Prm3p recruitment .

  • Domain deletion: Systematic deletion of defined domains (signal peptide, conserved domain, coiled-coil domains, transmembrane domains) provides clear separation of Kar5p's multiple functions .

  • Chimeric constructs: Creating fusion constructs between Kar5p and related proteins (such as utilizing the TM3 domain from S. pombe Tht1p) can improve expression and reveal functional conservation .

  • Combination mutations: Analyzing combinations of mutations can reveal functional interactions between domains and potential compensatory mechanisms .

  • Split-GFP tagging: Strategic placement of split-GFP tags enables determination of membrane topology and subcellular localization simultaneously .

By applying these approaches systematically, researchers can build a comprehensive understanding of how Kar5p's structure relates to its multiple functions in nuclear membrane fusion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.