Recombinant Saccharomyces cerevisiae Nuclear membrane organization protein APQ12 (APQ12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
APQ12; YIL040W; Nuclear membrane organization protein APQ12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
APQ12
Target Protein Sequence
MDATQPQYELSVVTQCLKSAIDVIQWLIPTITKFSQSHPLVFQLLFIFFTFYVFYKLLMN FITLVKRFLYLTLVVTCIGIYMRGSQQFLTVDLLNFYNFVMSNRYYAFKIYTLFINALER EINTVYHLAQMKMEQLLK
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Nuclear membrane organization protein APQ12 (APQ12) regulates lipid homeostasis within the endoplasmic reticulum, influencing nuclear pore complex biogenesis, localization, and nucleocytoplasmic mRNA transport.
Gene References Into Functions
  1. Apq12 interacts with the kinetochore, highlighting a novel link between nucleocytoplasmic transport and chromosome stability. PMID: 15998715
  2. Apq12 is essential for efficient nuclear pore complex biogenesis in *Saccharomyces cerevisiae*. PMID: 17724120
Database Links

KEGG: sce:YIL040W

STRING: 4932.YIL040W

Protein Families
APQ12 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is APQ12 and what is its structural organization?

APQ12 (encoded by the YIL040w locus in S. cerevisiae) is an integral membrane protein of approximately 16.5 kDa that functions in nuclear envelope (NE)/endoplasmic reticulum (ER) organization and nucleocytoplasmic mRNA transport . The protein contains two transmembrane domains connected by a short amphipathic α-helix (AαH) that extends into the perinuclear space . This amphipathic helix is critical for APQ12 function and has liposome-binding properties, suggesting it interacts directly with membrane lipids . While high-identity homologs (~80%) exist in several Saccharomyces species (S. paradoxus, S. mikatae, S. kudriavzevii, and S. bayanus), no obvious homologs have been identified in Schizosaccharomyces pombe or organisms outside fungi .

Where is APQ12 localized in the cell?

Fluorescence microscopy studies using yeGFP-tagged APQ12 reveal that the protein localizes to the nuclear envelope and the cell periphery, likely representing the peripheral ER . More precise immuno-electron microscopy has detected APQ12 along both the inner nuclear membrane (INM) and outer nuclear membrane (ONM), as well as in the cytoplasmic and cortical ER . Interestingly, while APQ12 associates with approximately 10% of nuclear pore complexes (NPCs), most NPCs are unlabeled, suggesting APQ12 may transiently interact with assembling NPCs rather than being a permanent structural component . This transient association pattern is similar to that observed for its partner proteins Brl1 and Brr6, supporting a model where these factors participate in NPC assembly but dissociate once the complexes are fully formed .

How does APQ12 contribute to nuclear pore complex biogenesis?

APQ12 plays a critical role in nuclear pore complex (NPC) biogenesis by working in conjunction with Brl1 and Brr6, two other integral membrane proteins . Cells expressing APQ12 versions with disrupted amphipathic α-helix (apq12-ah) show significant NPC biogenesis defects and disrupted nuclear envelope integrity . Immuno-electron microscopy studies have shown that APQ12 associates with NPC biogenesis intermediates at bent inner nuclear membrane segments, suggesting it may stabilize membrane deformations that occur during NPC assembly . The protein's amphipathic helix may generate or maintain membrane curvature at NPC biogenesis sites, similar to how other membrane-deforming proteins function . Additionally, APQ12 promotes local accumulation of phosphatidic acid (PA) at the nuclear envelope, which may facilitate the membrane remodeling required for NPC insertion .

What is the role of APQ12 in nucleocytoplasmic mRNA transport?

Multiple lines of evidence support APQ12's involvement in mRNA export from the nucleus to the cytoplasm:

  • Bulk poly(A)+ RNA is retained in the nucleus in apq12Δ cells, as demonstrated by in situ hybridization experiments .

  • APQ12 deletion results in 3' hyperadenylated mRNAs, a phenotype commonly observed in other RNA export mutants .

  • The half-life of reporter mRNAs is extended approximately twofold in apq12Δ mutants (from 6 minutes to 12 minutes for MFA2pG mRNA), consistent with a kinetic delay in nuclear export .

  • APQ12's perinuclear localization aligns with a role in mediating mRNA transport across the nuclear envelope .

These findings collectively indicate that APQ12 contributes to the efficient export of mRNA from the nucleus to the cytoplasm, although the precise mechanism remains to be fully elucidated.

What methods can be used to analyze APQ12 localization and topology?

Several complementary approaches have proven effective for studying APQ12 localization and topology:

  • Fluorescence microscopy: Tagging APQ12 with yeGFP allows visualization of its distribution at the nuclear envelope and peripheral ER .

  • Immuno-electron microscopy: This higher-resolution technique enables precise localization of APQ12 to specific membrane compartments (INM, ONM, cytoplasmic ER) using antibodies against tags such as GFP followed by protein A-gold labeling .

  • Topology analysis: The orientation of APQ12 within membranes can be determined through protease protection assays combined with Western blotting, which can reveal which domains face the cytoplasm versus the perinuclear/luminal space .

  • Subcellular fractionation: Biochemical separation of nuclear and ER membrane fractions, followed by immunoblotting, can quantitatively assess the distribution of APQ12 between different cellular compartments.

How can researchers assess the functional importance of APQ12's amphipathic α-helix?

The functional significance of APQ12's amphipathic α-helix (AαH) can be evaluated through multiple experimental approaches:

  • Mutagenesis studies: Introducing mutations that disrupt the amphipathicity of the helix (apq12-ah) while maintaining protein expression allows assessment of helix-specific functions .

  • Liposome binding assays: In vitro experiments with synthetic peptides corresponding to the AαH region can determine direct lipid binding capabilities. The AαH peptide from APQ12 has been shown to bind liposomes, confirming its membrane-active properties .

  • Complementation assays: Testing whether wild-type APQ12 or apq12-ah can rescue phenotypes in apq12Δ strains reveals the functional significance of the helix in vivo .

  • Overexpression studies: Comparing the effects of overexpressing wild-type APQ12 versus apq12-ah provides insights into helix-dependent functions. While APQ12 overexpression triggers ONM/ER proliferation and PA accumulation, apq12-ah overexpression does not produce these effects .

How does APQ12 interact with Brl1 and Brr6 during NPC biogenesis?

The interaction between APQ12, Brl1, and Brr6 represents a functional module critical for NPC assembly:

  • All three proteins transiently associate with assembling NPCs but dissociate once assembly is complete .

  • In cells with functional APQ12, Brl1 and Brr6 exhibit a uniform distribution throughout the nuclear envelope .

  • When APQ12 is overexpressed, Brl1 and Brr6 form dense clusters on the nuclear envelope that lack the NPC marker Nup85-tdTomato, suggesting APQ12 can regulate the distribution of these partner proteins .

  • Disruption of APQ12's amphipathic helix (apq12-ah) increases both Brl1 protein levels and the interaction between Brl1 and Brr6, indicating that the helix regulates the function of this protein complex .

  • While overexpression of APQ12 is toxic to cells, overexpression of BRL1 and BRR6 does not cause toxicity, highlighting a unique regulatory role for APQ12 in this functional module .

These observations suggest APQ12 acts as a regulator of Brl1-Brr6 interactions, with its amphipathic helix serving as a molecular switch that modulates the assembly and function of this protein complex during NPC biogenesis.

What is known about APQ12's role in membrane lipid regulation?

APQ12 appears to influence nuclear envelope lipid composition through several mechanisms:

  • Phosphatidic acid (PA) regulation: Overexpression of APQ12 promotes accumulation of PA at the nuclear envelope in a manner dependent on its amphipathic α-helix .

  • Lipid composition changes: Lipidomic analysis reveals that APQ12 overexpression triggers increases in diacylglycerol (DAG) and triacylglycerol (TAG) after 1 hour of induction, followed by increases in phosphatidylserine (PS) and ethyl esters (EE) after 3 hours .

  • Fatty acid modification: APQ12 overexpression affects the number of double bonds in glycerophospholipids and their chain length, suggesting it may influence fatty acid metabolism or incorporation into membrane lipids .

These lipid-modifying activities likely contribute to APQ12's role in membrane remodeling during NPC biogenesis, potentially by creating local lipid microenvironments that facilitate membrane deformation and fusion.

What are the consequences of APQ12 deletion or mutation on cell growth and morphology?

APQ12 deletion or mutation produces several distinct phenotypes:

  • Growth defects: apq12Δ strains are severely compromised for growth, displaying a much more severe phenotype than other viable mRNA export mutants .

  • Abnormal cell morphology: APQ12-deficient cells exhibit atypical morphology not observed with other export mutants, suggesting APQ12 may have additional cellular functions beyond mRNA export or preferentially affect the export of mRNAs regulating cell growth .

  • Cold sensitivity: Cells expressing the mutant apq12-ah are cold-sensitive for growth, indicating temperature-dependent requirements for APQ12 function .

  • Nuclear envelope defects: Both deletion and mutation of APQ12 result in disrupted nuclear envelope integrity, as assessed by microscopy techniques .

  • NPC biogenesis defects: APQ12-deficient cells show abnormalities in NPC assembly and distribution, contributing to nuclear transport deficiencies .

These phenotypes collectively indicate that APQ12 plays critical roles in fundamental cellular processes beyond just mRNA export, potentially including membrane organization, lipid homeostasis, and cell growth regulation.

How does APQ12 overexpression affect membrane proliferation?

Overexpression of APQ12 using a galactose-inducible promoter triggers dramatic membrane proliferation phenotypes:

  • ONM/ER expansion: Excessive APQ12 levels lead to striking over-proliferation of the outer nuclear membrane and ER structures .

  • Membrane extensions: Electron microscopy reveals the formation of ER tubes extending from the ONM, which can subsequently fuse with the nuclear envelope .

  • Cytoplasmic entrapment: The fusion of these membrane extensions with the nuclear envelope can trap cytoplasmic content within ONM-encircled compartments .

  • Helix dependence: These membrane proliferation effects require a functional amphipathic α-helix, as overexpression of apq12-ah does not produce the same phenotypes .

  • Specific toxicity: While APQ12 overexpression is toxic to cells, overexpression of its partner proteins BRL1 and BRR6 is not, suggesting APQ12 plays a unique role in membrane regulation .

The ability of APQ12 to induce membrane proliferation likely reflects its capacity to modulate lipid composition and/or membrane curvature, potentially through direct lipid binding via its amphipathic helix.

How does APQ12 relate to nuclear envelope surveillance mechanisms?

APQ12 functions within a broader context of nuclear envelope quality control:

  • While APQ12, Brl1, and Brr6 are nonstructural components of NPCs that function directly in NPC biogenesis, they differ from the Lap2-emerin-MAN1 (LEM) family proteins Heh1 and Heh2, which contribute to NPC biogenesis surveillance .

  • Heh1 activates Chm7 (a component of an ESCRT-III-like complex) to seal disrupted nuclear envelopes caused by NPC biogenesis defects, while Heh2 likely functions as a sensor for the assembly state of NPCs .

  • APQ12, Brl1, and Brr6 fulfill distinct functions from Heh1 and Heh2, focusing on the actual assembly process rather than quality control .

Understanding how APQ12 and its partners intersect with nuclear envelope surveillance mechanisms represents an important direction for future research, potentially revealing how cells coordinate NPC assembly with quality control to maintain nuclear envelope integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.