Recombinant Saccharomyces cerevisiae Nuclear rim protein 1 (NUR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us; we will prioritize its inclusion.
Synonyms
NUR1; SCY_0826; Nuclear rim protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-484
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
NUR1
Target Protein Sequence
MGSNDLINEAYDDSEVVGEERESKSAWMKRWYQLLTSPLDLQLVINEKLEMINWDAYAKS LAKPLGNFLTILFFIIRLLQDNLIKPNYYKLNVKSGAFDLSKSNKLKEFDYLWEISSSFQ NSNQFYAFQSWYFVTLRFLNNLFRFTIFILLSLNLYVSCKFMFGYFKTYNLFHLKKEFNS PNLTKHNLKDLSKEYYEDIYKQSLWSMLKHFFRGSRDDGPHVNQNEVEIFFQLRKWIPTN FMINLFVSFSPTAIVFLSFSDVSFTSAIAIVFHQYILDYIITKRFQRSVDDDLILSSAAL QEYEDKHIMARINQCSNIDTLSSAMGTRSKTPRIFTTHSLCGEEIREVYNYEKREFEALP KMTESVPGSRETRIKDYGGISQVSDNQSHPIGFHYSPRMSPYYRDKVLDNNLAQSSSNEN LEKGGAFLPNQDQNRPSKSLSPLRKTPLSARQKRFEGSEFNVLNKNDINSILRSPKKKKN YHKR
Uniprot No.

Target Background

Function
NUR1 (Nuclear rim protein 1) is a component of a perinuclear network that regulates recombination at multiple loci to maintain genomic stability. It plays a crucial role in maintaining rDNA repeat stability.
Protein Families
NUR1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Nuclear Rim Protein 1 (NUR1) and what is its role in Saccharomyces cerevisiae?

Nuclear Rim Protein 1 (NUR1/Rip1p/Nup42p) is a nucleoporin that forms part of the nuclear pore complex (NPC) in Saccharomyces cerevisiae. It is categorized as a "late" factor in the mRNA export pathway, primarily associating with the NPC rather than traveling with the mRNA through the nucleoplasm. NUR1 functions as a static component that facilitates the final steps of mRNA export from the nucleus to the cytoplasm .

Methodologically, researchers can confirm NUR1's localization and function through:

  • Immunofluorescence microscopy to visualize its position at the nuclear rim

  • Co-immunoprecipitation experiments to identify interaction partners

  • Deletion or conditional mutation studies to observe effects on mRNA export

How does NUR1 contribute to mRNA export mechanisms?

NUR1/Rip1p works in conjunction with other nucleoporins like Nup159p/Rat7p to facilitate the final steps of mRNA export. When NUR1 is deleted or mutated (as in Δrip1 strains), a rapid accumulation of mRNAs in intranuclear foci occurs, typically near transcription sites. This retention phenotype is characteristic of mutations in several mRNA export factors .

Research methodologies to study this process include:

  • Heat shock experiments (30 minutes at restrictive temperature) to induce nuclear retention of mRNAs

  • Fluorescent in situ hybridization (FISH) to visualize retained mRNAs

  • Analysis of the spatial relationship between retained mRNAs and their transcription sites

What expression systems are suitable for producing recombinant NUR1?

Saccharomyces cerevisiae itself serves as an excellent expression system for recombinant nucleoporins like NUR1. The yeast expression system offers several advantages for nuclear proteins:

  • Natural post-translational modifications relevant to nuclear proteins

  • Proper protein folding in a eukaryotic environment

  • Compatible subcellular targeting mechanisms

For expression, researchers should consider approaches similar to those used for other complex membrane-associated proteins. For example, multi-copy yeast-Escherichia coli shuttle vectors (like pMB01 and pMB02) have been successfully used for expressing recombinant membrane proteins in yeast .

How can I detect and localize recombinant NUR1 in yeast cells?

Detection and localization of recombinant NUR1 can be achieved through multiple complementary techniques:

  • Western blotting using antibodies against the C-terminus of NUR1 or added epitope tags

  • Immunofluorescence microscopy to visualize cellular localization

  • Subcellular fractionation to isolate nuclear membrane fractions

For optimal results, antibodies should target conserved C-terminal sequences, as demonstrated with other recombinant nuclear proteins expressed in yeast. Recombinant proteins can be detected in cell membrane preparations, with partial glycosylation observed in some cases .

What methodologies are most effective for studying NUR1's interactions with the mRNA export machinery?

To comprehensively analyze NUR1's interactions with the mRNA export machinery, researchers should implement a multi-faceted approach:

  • Chromatin Immunoprecipitation (ChIP) Assays: While NUR1 itself is not directly chromatin-associated, ChIP assays can identify its interactions with "early" mRNA export factors like Sub2p and Yra1p that associate with mRNA near chromatin .

  • Co-Immunoprecipitation Studies: These can reveal NUR1's interactions with the Mex67p/Mtr2p heterodimer and other "intermediate" factors that shuttle between the transcription site and the NPC.

  • FRET/FLIM Analysis: For studying dynamic protein-protein interactions in living cells.

  • Nuclear Retention Assays: Compare wild-type and mutant strains to evaluate how specific mutations affect mRNA export efficiency.

TechniqueApplicationData OutputLimitations
ChIP AssaysIdentifying chromatin-proximal interactionsEnrichment of specific DNA sequencesIndirect for late factors like NUR1
Co-IPProtein-protein interactionsBinding partners identifiedMay miss transient interactions
FRET/FLIMDynamic interactions in live cellsReal-time interaction dataComplex setup and analysis
Nuclear Retention AssaysFunctional impact on mRNA exportmRNA distribution patternsPhenotypic rather than mechanistic

How can I distinguish between the different roles of NUR1 and other nucleoporins in mRNA export studies?

Distinguishing the specific contributions of NUR1 from other nucleoporins requires careful experimental design:

  • Sequential Deletion/Mutation Studies: Create single and combination mutants of different nucleoporins (NUR1/Rip1p, Nup159p/Rat7p) to identify unique versus redundant functions.

  • mRNA Export Kinetics Analysis: Compare export rates in different mutant backgrounds using pulse-chase RNA labeling.

  • Differential RNA-Binding Studies: Determine if NUR1 shows preferential binding to specific mRNA species compared to other nucleoporins.

  • Structure-Function Analysis: Generate domain-specific mutations in NUR1 to map functional regions.

A critical experimental approach involves incubating yeast mRNA export mutants (Δrip1 or rat7-1) at restrictive temperatures and analyzing the localization patterns of retained mRNAs. This helps differentiate the specific roles of each nucleoporin in the export pathway .

What are the most robust methods for assessing how NUR1 mutations affect nuclear mRNA retention?

To effectively analyze nuclear mRNA retention phenotypes in NUR1 mutants:

  • Combined FISH and Immunofluorescence: This dual approach allows simultaneous visualization of retained mRNAs and nuclear structures. Particularly effective is the analysis of heat shock mRNAs like SSA4, which can be easily induced and tracked .

  • 3D Confocal Microscopy: For spatial mapping of retained mRNAs relative to the gene locus and nuclear structures.

  • RNA-Seq of Nuclear Fractions: To comprehensively identify all retained RNA species.

  • Live-Cell Imaging: Using MS2-tagged mRNAs to track export defects in real-time.

The involvement of the nuclear exosome in RNA retention provides an important experimental control: deletion of the exosome component Rrp6p leads to release of retained RNAs. This allows researchers to distinguish between retention mechanisms and the fate of released RNAs .

How does the exosome component Rrp6p influence NUR1-mediated mRNA retention?

The nuclear RNA exosome, particularly its component Rrp6p, plays a crucial role in retaining mRNAs in intranuclear foci when mRNA export is impaired. Research shows that when Rrp6p is deleted in export mutant strains:

  • Heat shock mRNAs are released from their retention sites near the gene locus

  • Released mRNAs in the rat7-1 strain predominantly relocalize to the nucleolus

  • This contrasts with bulk poly(A)+ RNA, which primarily localizes to the nuclear rim

This differential behavior suggests a complex interplay between NUR1/nucleoporins, the nuclear exosome, and different RNA species.

ConditionHeat Shock mRNA LocationBulk poly(A)+ RNA Location
Wild-typeCytoplasmicCytoplasmic
mRNA export mutant (with Rrp6p)Near gene locusNuclear rim
mRNA export mutant (Rrp6p deleted)NucleolarNuclear rim

These findings highlight the importance of designing experiments that can distinguish between different RNA populations when studying mRNA export defects in NUR1 mutants.

What are the key considerations for designing a recombinant NUR1 expression system?

When designing expression systems for recombinant NUR1, researchers should consider:

  • Vector Selection: Multi-copy yeast-E. coli shuttle vectors are recommended for optimal expression. Systems like pMB01 and pMB02 have proven successful for expressing complex membrane-associated proteins in yeast .

  • Strain Selection: Protease-deficient S. cerevisiae strains (e.g., cI3-ABYS-86) can enhance protein yield by preventing degradation. Consider auxotrophic markers (leu-, ura-) for selection .

  • Expression Control: Use inducible promoters to regulate expression levels and timing.

  • Fusion Tags: Strategic placement of epitope tags is crucial - C-terminal tags are generally preferred for nucleoporins to avoid disrupting N-terminal targeting sequences.

  • Glycosylation Considerations: Be aware that recombinant proteins expressed in yeast may be partially glycosylated, which can affect function and detection .

How can coincidence analysis improve the study of NUR1 function?

Coincidence analysis represents a novel approach for examining complex biological systems with multiple interacting components. For studying NUR1 function:

  • Multiple Condition Monitoring: This approach can identify combinations of conditions that uniquely affect NUR1 function or localization.

  • Pathway Analysis: Coincidence analysis can help reduce complex datasets to smaller subsets of candidate conditions, revealing key functional pathways .

  • Implementation Strategy:

    • Sort conditions by complexity (number of conditions in a solution path)

    • Identify configurations with highest coverage scores

    • Examine relationships from simple to complex to minimize redundancy

    • Aim for solutions with >70% consistency and >66% coverage with no model ambiguity

This analytical approach is particularly valuable for understanding how NUR1 functions within the larger context of the nuclear pore complex and mRNA export machinery.

How can de novo design approaches be applied to study NUR1 structure and function?

While traditional structural biology methods remain valuable, computational de novo design approaches offer new possibilities for studying nuclear pore proteins like NUR1:

  • Chemical Language Models (CLMs): These neural networks can design innovative molecules that interact with specific protein domains, even with limited template data .

  • Fragment-Augmented Design: For targets with limited structural data (like many nucleoporins), fragment-augmented approaches can enhance design capabilities using minimal templates .

  • Application to NUR1 Research:

    • Design of small-molecule probes that specifically bind NUR1

    • Development of inhibitors to study functional domains

    • Creation of fluorescent ligands for live imaging

The sampling frequency approach, which has proven effective in de novo design scenarios with limited data, could be particularly valuable for nucleoporin research where structural information may be incomplete .

What next-generation imaging techniques are most promising for studying NUR1 dynamics?

Advanced imaging techniques offer unprecedented insights into the dynamic behavior of nucleoporins like NUR1:

  • Super-Resolution Microscopy:

    • STED (Stimulated Emission Depletion)

    • PALM/STORM (Photoactivated Localization/Stochastic Optical Reconstruction Microscopy)

    • These techniques overcome the diffraction limit, allowing visualization of NUR1 within the complex NPC structure

  • Single-Molecule Tracking:

    • Allows tracking of individual NUR1 molecules in living cells

    • Provides insights into mobility, residence time, and interaction dynamics

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines fluorescence imaging of NUR1 with ultrastructural context

    • Particularly valuable for positioning NUR1 within the NPC architecture

  • Lattice Light-Sheet Microscopy:

    • Enables 3D imaging with minimal photodamage

    • Ideal for long-term imaging of nuclear dynamics

These advanced imaging approaches, combined with appropriate tagging strategies and experimental controls, will be essential for understanding the dynamic behavior of NUR1 in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.