Recombinant Saccharomyces cerevisiae Nucleoporin POM34 (POM34)

Shipped with Ice Packs
In Stock
Cat. No.
BT2447193
Source
in vitro E.coli expression system
Synonyms
POM34; YLR018C; Nucleoporin POM34; Nuclear pore protein POM34; Pore membrane protein POM34
Quick Inquiry

Description

Protein Overview

POM34 is a non-essential transmembrane protein localized exclusively to the NPC in S. cerevisiae. Recombinant POM34 is typically expressed in E. coli with an N-terminal His tag for purification . Key characteristics include:

PropertyDetails
UniProt IDQ12445
Gene NamePOM34 (synonyms: YLR018C, Pom34p)
Protein LengthFull-length (1–299 amino acids)
Molecular Weight~93 kDa (predicted)
Expression SystemE. coli
Purification≥85%–90% purity (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Insights

POM34 interacts with multiple nucleoporins (Nups) and contributes to NPC structural integrity:

  • Genetic Interactions: Synthetic lethality occurs in double mutants with nup170Δ, nup188Δ, nup59Δ, gle2Δ, nup159Δ, and nup82Δ . Functional complementation studies revealed allele-specific requirements for the N- or C-terminal regions in rescuing these mutants .

  • NPC Subcomplex: POM34 forms a transmembrane complex with Ndc1 and Pom152, which stabilizes NPC architecture . Disruption of this complex leads to pore dilation and nucleoporin mislocalization .

  • Role in Biogenesis: Depletion of POM34 in nup53Δ nup59Δ cells blocks new NPC assembly, causing cytoplasmic accumulation of newly synthesized Nup82 .

Research Applications

Recombinant POM34 is utilized in:

  • Antibody Production: Rabbit polyclonal antibodies against POM34 enable detection in Western blot (WB) and ELISA .

  • Interaction Studies: Affinity purification assays identify binding partners like Ndc1 and Pom152 .

  • Structural Analysis: Topology mapping and domain-deletion mutants clarify functional regions .

Key Findings from Peer-Reviewed Studies

  1. Functional Redundancy: POM34 and POM152 deletions are synthetically viable, but overexpression of Pom152 rescues pom34Δ nup170Δ and pom34Δ nup59Δ lethality .

  2. Transport Defects: The pom34Δ nup188Δ mutant inhibits nuclear import via Kap104p and Kap121p pathways .

  3. Evolutionary Conservation: POM34 homologs exist in fission yeast (Schizosaccharomyces pombe Mug31) , highlighting conserved NPC roles.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
POM34; YLR018C; Nucleoporin POM34; Nuclear pore protein POM34; Pore membrane protein POM34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
POM34
Target Protein Sequence
MKIQAGQLGLDDNDVPGPLPDTDSKPSSQSQNDTPMFKLGNFESPVLKELSRRTVNKEME TQRIMTNVIAFAFWNLLVKFIKFFWNNTHVGRQFCNRLSRIHLYMLTFHTLKKANIIYHT TFSWLNAELLDYLFHLLISLNILFSLWKLLSTVKVSDLNLTDRQKKLLGVDMQSSVDTGL QPQHPHYVSTSKISQMAQNKTHIPQTNLKNHPAYLFKGLETPLKARQREMAEEQTKLQSQ SLHTKNVFGTLQRHSGISSTLVSANNDNNSPHTPVTRKGYIPSSKYAYMMNSQSPRGKI
Uniprot No.
Q12445

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Nucleoporin POM34 functions as a component of the nuclear pore complex (NPC). NPC components, collectively known as nucleoporins (NUPs), serve dual roles: as structural components of the NPC and as docking or interaction partners for transiently associated nuclear transport factors.
Gene References Into Functions
  1. Studies demonstrate reduced POM34 protein levels in cells with altered membrane lipid composition following treatment with various chemicals, highlighting the crucial role of SESA-induced POM34 downregulation in the viability of cells with compromised nuclear envelopes. PMID: 26419396
  2. Genetic interaction networks between POM34 and genes encoding integral membrane proteins within the nuclear pore domain or nuclear envelope suggest coordinated structural and functional roles. PMID: 16361228
Database Links

KEGG: sce:YLR018C

STRING: 4932.YLR018C

Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein. Note=Central core structure of the nuclear pore complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.