Recombinant Saccharomyces cerevisiae Nucleus export protein BRR6 (BRR6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
BRR6; YGL247W; NRA197; Nucleus export protein BRR6; Bad response to refrigeration protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
BRR6
Target Protein Sequence
MELRSFSRQPDGILANPRLGREEVLEGEHPQDARLARQSIWLSPSLIAEYIQLFFNFIIG TIGLSLAIKFILMIRNDVNLKLEHNVREELDKIATCKSRYFENQCEPHMRVPALEVRCNE WSKCMNKEIVSGSDYQWAKAWARTLAEVINAFFEAFSIRSFLFILISIIGIIFVTNTSFG SYRVYLNNKDTKSVRHA
Uniprot No.

Target Background

Function
Required for mRNA nuclear export. It is involved in nuclear pore complex (NPC) distribution and nuclear envelope morphology.
Gene References Into Functions
  1. Brl1p functions in nuclear export as a complex with Brr6p. [PMID: 15882446](https://www.ncbi.nlm.nih.gov/pubmed/15882446)
Database Links

KEGG: sce:YGL247W

STRING: 4932.YGL247W

Protein Families
BRL1/BRR6 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Q&A

What is BRR6 and what is its primary function in Saccharomyces cerevisiae?

BRR6 is a conserved integral membrane protein located in the nuclear envelope (NE) of Saccharomyces cerevisiae. Its primary function involves nuclear pore complex (NPC) biogenesis, where it plays an essential role in the assembly of new NPCs without affecting already established ones . BRR6 also functions in regulating lipid homeostasis in the nuclear envelope-endoplasmic reticulum (NE-ER) membrane system, which directly impacts NPC formation and nucleocytoplasmic transport processes . Research indicates that BRR6, along with its paralog BRL1, localizes to NPC assembly sites where they facilitate the integration of various nucleoporins into the forming complex.

Methodologically, researchers can study BRR6 function through temperature-sensitive mutant strains (particularly brr6-1), with restrictive conditions typically at 23°C rather than the elevated temperatures used for many other yeast mutants .

How is BRR6 structurally characterized and localized in the cell?

BRR6 is characterized as an integral membrane protein embedded in the nuclear envelope. Experimentally, its localization can be visualized using fluorescent protein tagging techniques, which have revealed that BRR6 associates with a subpopulation of NPCs and emerging NPC assembly sites rather than being uniformly distributed throughout the nuclear envelope .

To study BRR6 localization, researchers commonly employ:

  • Fluorescent protein tagging (GFP, YFP) for live-cell imaging

  • Immunofluorescence microscopy using anti-BRR6 antibodies

  • Split-YFP analysis to identify protein-protein interactions at the nuclear envelope

Research findings show that BRR6 transiently associates with NPC assembly sites, suggesting a dynamic rather than static localization pattern . This transient association provides key insights into its functional role during NPC biogenesis.

What is the relationship between BRR6 and BRL1?

BRR6 and BRL1 are paralogous proteins with partially overlapping functions in the nuclear envelope. Both proteins are essential for cell viability and NPC biogenesis. Their relationship can be characterized as follows:

CharacteristicBRR6BRL1Shared Features
Restrictive Temperature23°C34°CTemperature-sensitive
Cellular LocalizationNuclear envelopeNuclear envelopeMembrane-embedded
FunctionNPC biogenesis, lipid homeostasisNPC biogenesis, lipid homeostasisEssential for cell viability
Interaction PartnersNPCsNdc1, Nup188, and other nucleoporinsNPC components

To study their functional relationship, researchers utilize double-degron mutants of BRR6/BRL1, which allow for controlled depletion of both proteins simultaneously . This experimental approach has revealed that depletion of both proteins causes severe defects in NPC biogenesis without affecting already assembled NPCs, indicating their specific role in the assembly process rather than maintenance .

How do mutations in BRR6 affect cellular processes in yeast?

Mutations in BRR6 impact multiple cellular processes, primarily affecting nuclear pore complex assembly and cell division. Key phenotypes observed in brr6 mutants include:

  • Defective NPC biogenesis leading to nucleocytoplasmic transport disruption

  • Abnormal nuclear envelope morphology

  • Cell division defects with cells failing to complete cytokinesis at restrictive temperatures

  • Weakened cell wall structure, with mutants showing increased sensitivity to zymolyase treatment

  • Accumulation of cellular debris after only 1 hour of exposure to zymolyase levels that do not compromise wild-type cell integrity

Calcofluor white staining experiments on brr6-1 strains at restrictive temperature (23°C) have revealed concentrated areas of chitin at cell junctions and an increased number of failures to complete cell division . This suggests that while nuclear division proceeds normally, physical separation of daughter cells is impaired in brr6 mutants.

What are the recommended protocols for studying BRR6 mutants?

When studying BRR6 mutants, researchers should implement the following methodological approaches:

  • Temperature-sensitive strain cultivation: The brr6-1 strain exhibits restrictive growth at 23°C, while the wild-type grows normally at this temperature. This inverse temperature sensitivity (compared to most temperature-sensitive mutants that are defective at higher temperatures) requires careful experimental design .

  • Cell wall integrity assessment: Use zymolyase digestion analysis to evaluate cell wall strength and integrity in brr6 mutants. Standardized protocol involves:

    • Growing cells to mid-log phase at permissive temperature

    • Shifting to restrictive temperature for specified time periods (1-3 hours)

    • Treating with zymolyase (5-10 μg/ml)

    • Monitoring optical density decrease as an indicator of cell lysis

    • Comparing kinetics with wild-type controls

  • Cytokinesis and cell separation analysis: Implement Calcofluor white staining to visualize chitin localization at bud necks and cell junctions. This technique effectively reveals cytokinesis completion defects in brr6 mutants .

  • Nuclear content visualization: Use DAPI (4′,6-diamidino-2-phenylindole) staining to confirm that nuclear division proceeds normally despite cytokinesis defects, as observed in aggregated brr6 mutant cells that contain individualized genetic material .

How can researchers effectively analyze BRR6's role in nuclear pore complex assembly?

To analyze BRR6's role in NPC assembly, researchers should employ a multimodal approach:

  • Degron-based protein depletion: Construct double-degron mutants of BRR6/BRL1 to allow controlled depletion of both proteins. This system enables temporal analysis of NPC assembly defects without affecting existing NPCs .

  • Immunoprecipitation assays: Use immobilized recombinant BRR6 to isolate interaction partners from yeast lysates. This approach has successfully identified associations with other nuclear envelope proteins .

  • Split-YFP analysis: Implement this technique to verify direct protein-protein interactions between BRR6 and NPC components in living cells. This method has confirmed interactions between BRL1 and transmembrane, outer ring, and inner ring NPC components .

  • Fluorescence microscopy: Track NPC assembly using fluorescently tagged nucleoporins, comparing assembly rates and distribution patterns between wild-type and brr6 mutant cells.

  • Electron microscopy: Employ transmission electron microscopy to visualize NPC structural abnormalities and nuclear envelope morphology changes in brr6 mutants.

Research findings indicate that BRR6 transiently associates with NPC assembly sites rather than with mature NPCs, suggesting a specific role in the assembly process rather than maintenance of existing structures .

What approaches are effective for studying interactions between BRR6 and other nuclear proteins?

Multiple complementary approaches yield robust results when studying BRR6 interactions:

  • Biochemical co-isolation: Use immobilized recombinant BRR6 to isolate interacting proteins from yeast lysate. This technique has successfully identified specific protein complexes containing BRR6 .

  • Coimmunoprecipitation: Implement this approach using epitope-tagged BRR6 to pull down associated proteins directly from yeast lysates, verifying interactions under native conditions .

  • Yeast two-hybrid screening: Though not mentioned specifically for BRR6 in the search results, this system provides a powerful genetic approach to screen for potential interaction partners.

  • Split-fluorescent protein complementation: This in vivo method allows visualization of protein interactions in their native cellular context and has successfully demonstrated interactions between BRL1 (BRR6 paralog) and various NPC components .

  • Genetic interaction studies: Analyze synthetic genetic interactions by combining brr6 mutations with mutations in genes encoding potential interacting proteins.

The combination of these approaches has revealed that BRR6 and its paralog BRL1 interact with multiple nuclear pore complex proteins, including the transmembrane nucleoporin Ndc1 and the scaffold nucleoporin Nup188 .

What is the molecular mechanism by which BRR6 influences nuclear pore complex biogenesis?

The molecular mechanism underlying BRR6's role in NPC biogenesis involves several coordinated processes:

  • Transient association with assembly sites: BRR6 and BRL1 localize specifically to emerging NPC assembly sites rather than being uniformly distributed throughout the nuclear envelope or associating with mature NPCs . This suggests a scaffolding function during early assembly phases.

  • Protein-protein interactions: BRL1 (paralog of BRR6) directly interacts with key NPC components including:

    • Transmembrane nucleoporins (specifically Ndc1)

    • Scaffold nucleoporins (Nup188)

    • Outer and inner ring components

  • NPC assembly promotion: BRR6/BRL1 depletion specifically affects the formation of new NPCs without disrupting existing ones, indicating a role in assembly rather than maintenance .

  • Suppression of assembly defects: Notably, BRL1 overexpression completely suppresses the nuclear pore biogenesis defects observed in nup116Δ and gle2Δ cells . This genetic suppression provides strong evidence for a direct functional role in the NPC assembly pathway.

  • Nuclear envelope remodeling: BRR6 and BRL1 facilitate the nuclear envelope membrane remodeling required for NPC insertion, likely by mediating interactions between the nuclear envelope and assembling NPC components .

Importantly, research findings indicate that BRR6/BRL1's role in NPC biogenesis is not mediated through changes in lipid composition, as depletion of these proteins does not significantly alter the nuclear envelope lipid profile despite causing severe NPC assembly defects .

How does BRR6 contribute to cell wall integrity and cytokinesis?

BRR6's role in cell wall integrity and cytokinesis represents a distinct function from its involvement in NPC biogenesis. Experimental evidence reveals:

  • Cell wall weakening: Zymolyase digestion analysis shows that brr6-1 mutants accumulate cellular debris after only 1 hour of exposure to enzyme concentrations that do not compromise wild-type cell integrity, indicating fundamental cell wall structural defects .

  • Cytokinesis failure: Calcofluor white staining of brr6-1 strains reveals an increased number of failures to complete cell division at restrictive temperature (23°C), with concentrated chitin deposits at cell junctions .

  • Nuclear division completion: DAPI staining confirms that aggregated cells in brr6 mutants contain individualized genetic material, indicating that nuclear division completes successfully despite cytokinesis defects .

  • Independence from Mitotic Exit Network: Experiments comparing brr6 and brl1 mutants with known conditional mutants of mob1 (a MEN component) showed no significant correlation between BRR6/BRL1 and MEN functionality . This suggests that BRR6's role in cytokinesis operates through a MEN-independent pathway.

The molecular mechanism likely involves BRR6's contribution to localized cell wall remodeling during final cell separation, potentially through:

  • Regulation of cell wall-degrading enzyme secretion or localization

  • Influence on cell wall composition at the division site

  • Coordination of membrane dynamics during abscission

This function appears separable from BRR6's role in NPC assembly, indicating multiple distinct cellular roles for this integral membrane protein .

What is the relationship between BRR6 and nucleocytoplasmic transport?

BRR6's relationship with nucleocytoplasmic transport involves both direct and indirect mechanisms:

  • NPC assembly facilitation: By promoting proper NPC biogenesis, BRR6 indirectly ensures the presence of functional transport channels between the nucleus and cytoplasm .

  • Lipid homeostasis regulation: BRR6 has an essential function in regulating lipid composition in the nuclear envelope-endoplasmic reticulum membrane system, which impacts membrane fluidity and flexibility required for NPC function .

  • Interaction with transport factors: While specific RNA export factors like Nab2 interact with nuclear pore components , the search results don't explicitly establish direct interactions between BRR6 and RNA export machinery.

The functional consequences of BRR6 disruption on nucleocytoplasmic transport include:

  • Defects in protein import into the nucleus

  • Impaired mRNA export

  • Disruption of normal nucleocytoplasmic compartmentalization

Research using nuclear transport assays in brr6 mutants would provide valuable insights into the specific transport pathways affected by BRR6 dysfunction. Such assays could include:

  • Nuclear protein import assays using reporter proteins

  • mRNA export analysis using FISH (fluorescence in situ hybridization)

  • Quantification of nuclear accumulation of poly(A)+ RNA

How can researchers address data contradictions in BRR6 function studies?

When encountering contradictory data regarding BRR6 function, researchers should implement a systematic approach to resolve inconsistencies:

  • Compare experimental conditions: The temperature-sensitive nature of brr6 mutants (restrictive at 23°C for brr6-1) can lead to confounding results if temperature conditions are not precisely controlled . Researchers should document and standardize:

    • Growth temperatures (pre-shift and experimental)

    • Duration of temperature shifts

    • Medium composition

    • Cell density during experiments

  • Distinguish direct vs. indirect effects: Some phenotypes may represent secondary consequences of BRR6 dysfunction rather than direct functional roles. Implement time-course experiments to establish temporal relationships between different phenotypes.

  • Utilize novel contradiction detection methodologies: Apply systematic approaches such as those described by Pielka et al. for identifying and categorizing types of contradictions in experimental data .

  • Cross-validate with multiple techniques: When contradictory results emerge, verify findings using orthogonal experimental approaches. For example:

    • Complement genetic studies with biochemical analysis

    • Validate in vivo observations with in vitro reconstitution

    • Compare results from fixed-cell imaging with live-cell analysis

  • Consider strain background effects: Different yeast strain backgrounds can influence mutant phenotypes. Researchers should perform experiments in multiple strain backgrounds to identify potentially background-specific effects.

A standardized contradiction analysis framework for BRR6 studies might include:

Contradiction TypeExample in BRR6 ResearchResolution Approach
Temperature dependenceDifferent phenotypes at 23°C vs. 30°CComprehensive temperature series analysis
Functional discrepancyRole in NPC assembly vs. lipid homeostasisTime-resolved depletion experiments
Genetic interaction conflictsInconsistent genetic suppression patternsStandardized overexpression/deletion platform
Localization inconsistenciesDifferent reported subcellular distributionsMulti-color, multi-tag imaging approaches

What emerging technologies could advance BRR6 research?

Several cutting-edge technologies offer promising avenues for deeper insights into BRR6 function:

  • Cryo-electron tomography: This technique could reveal the three-dimensional architecture of NPCs in brr6 mutants at nanometer resolution, providing structural insights into assembly defects.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 could identify the complete interactome of BRR6 at different stages of the cell cycle and during NPC assembly.

  • Single-molecule tracking: This approach could reveal the dynamics of BRR6 movement within the nuclear envelope and its transient associations with assembling NPCs.

  • Genome-wide CRISPR screens: Systematic genetic interaction studies using CRISPR technology could identify novel functional connections between BRR6 and other cellular pathways.

  • Reconstitution systems: In vitro reconstitution of NPC assembly using purified components, including recombinant BRR6, could provide mechanistic insights into its direct role in the assembly process.

  • Super-resolution microscopy: Techniques like STORM or PALM could visualize BRR6 localization relative to NPC components with unprecedented spatial resolution, revealing previously undetectable organizational patterns.

  • Microfluidics-based single-cell analysis: This approach could characterize cell-to-cell variability in BRR6 function and provide insights into its role during different cell cycle stages.

How might research on BRR6 inform understanding of related human diseases?

Though the search results don't directly address human disease connections, the fundamental roles of BRR6 in nuclear pore complex assembly and cell division have significant implications for human health:

  • Cancer research: The cell division defects observed in brr6 mutants could provide insights into mechanisms of cytokinesis failure in cancer cells . Abnormal nuclear pore complex assembly is increasingly recognized as a feature of various cancers.

  • Neurodegenerative diseases: Nuclear transport defects contribute to several neurodegenerative disorders, including amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD). Understanding fundamental NPC assembly mechanisms through BRR6 research could illuminate disease mechanisms.

  • Aging: Nuclear pore complex integrity declines with age, contributing to various aging phenotypes. BRR6's role in NPC assembly may provide insights into age-related nuclear transport defects.

  • Viral infections: Many viruses interact with or manipulate the nuclear transport machinery. Understanding fundamental NPC assembly through BRR6 research could inform antiviral strategies.

Research approaches connecting BRR6 to human disease models might include:

  • Identification and characterization of human homologs of BRR6/BRL1

  • Expression of human NPC assembly factors in yeast brr6 mutants to test functional conservation

  • Analysis of BRR6-like protein expression or mutation in human disease tissue samples

  • Development of small molecule modulators of BRR6 function as research tools

What are the key outstanding questions in BRR6 research?

Several fundamental questions remain unanswered in the field of BRR6 research:

  • Molecular mechanism: What is the precise molecular mechanism by which BRR6 promotes NPC assembly? Does it function as a scaffold, an enzyme, or a regulatory factor?

  • Temporal dynamics: How is BRR6 activity regulated throughout the cell cycle, particularly during phases of active NPC assembly?

  • Functional domains: Which specific domains of BRR6 mediate its various functions in NPC assembly, lipid homeostasis, and cell division?

  • Evolutionary conservation: To what extent are BRR6 functions conserved in higher eukaryotes, and which human proteins perform analogous roles?

  • Integration of functions: How are BRR6's distinct roles in NPC assembly, lipid regulation, and cell division coordinated? Do these represent truly separate functions or different aspects of a unified cellular role?

  • Regulatory networks: What signaling pathways regulate BRR6 activity, localization, or expression levels?

  • Structural insights: What is the three-dimensional structure of BRR6, and how does this structure enable its functions at the nuclear envelope?

  • Interaction hierarchy: What is the order of assembly for BRR6-containing complexes during NPC biogenesis?

Addressing these questions will require integrated approaches combining genetic, biochemical, and advanced imaging techniques to build a comprehensive model of BRR6 function in cellular processes.

What are the recommended protocols for purifying recombinant BRR6 protein?

While the search results don't provide specific protocols for BRR6 purification, the following methodological approach is recommended based on similar integral membrane proteins:

  • Expression system selection:

    • E. coli with specialized membrane protein expression vectors

    • Yeast expression systems for proper folding and modification

    • Insect cell expression systems for higher yields

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, MNG-3) for efficient extraction

    • Optimize detergent:protein ratios

    • Consider nanodiscs or amphipols for maintaining native structure

  • Purification strategy:

    • Affinity chromatography using epitope tags (His, GST, MBP)

    • Size exclusion chromatography for final polishing

    • Consider on-column detergent exchange during purification

  • Functional verification:

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays to assess protein quality

    • In vitro binding assays with known interaction partners

For in vitro studies, researchers have successfully used immobilized recombinant BRR6 to isolate interaction partners from yeast lysates , suggesting that functional recombinant protein can be produced with appropriate methods.

What controls should be included in BRR6 functional assays?

Robust experimental design for BRR6 functional studies requires appropriate controls:

  • Genetic controls:

    • Wild-type BRR6 strain (positive control)

    • brr6-1 temperature-sensitive mutant at permissive temperature (23°C for growth)

    • brr6-1 at restrictive temperature (functional negative control)

    • brl1 mutants to distinguish paralog-specific functions

    • Double degron BRR6/BRL1 mutants for complete depletion studies

  • Experimental controls for NPC assembly studies:

    • Pre-existing NPC markers to distinguish assembly defects from maintenance defects

    • Time-course analysis to establish temporal relationships

    • Multiple NPC component markers to assess assembly sequence

  • Cell wall integrity experiment controls:

    • Standardized zymolyase concentrations with wild-type controls

    • Multiple time points to establish degradation kinetics

    • Parallel assessment of known cell wall mutants

  • Specificity controls:

    • Rescue experiments with wild-type BRR6 expression

    • Structure-function analysis with domain mutants

    • Heterologous complementation with homologs from other species

  • Technical controls:

    • Multiple biological replicates across independent experiments

    • Blind scoring of phenotypes when possible

    • Quantitative image analysis with statistical validation

These comprehensive controls enable robust interpretation of experimental results and distinction between direct and indirect effects of BRR6 manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.