Recombinant Saccharomyces cerevisiae Nucleus-vacuole junction protein 1 (NVJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NVJ1; VAB36; SCY_2585; Nucleus-vacuole junction protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-321
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
NVJ1
Target Protein Sequence
VEKTVRKHLERQGWIEPQKVDYELIFTIDRLKNLVDNKREALTAEQPDAGELSWRKVFNF ISRQSSELDARIYVLILLLSFLLPIAWTVLDGDRETTLEDKDNDCNVDLIENERRLKHYN DGERAVLQFGKNRSEPIILSYKDMNVLEGEHEFTSKEEHSNSHLTSKSENALSQVGSEDL LGCHLEKQLEEDKNEPNGEADGEDDNNREKDCSSSSEVESQSKCRKESTAEPDSLSRDTR TTSSLKSSTSFPISFKGSIDLKSLNQPSSLLHIQVSPTKSSNLDAQVNTEQAYSQPFRY
Uniprot No.

Target Background

Function

Recombinant Saccharomyces cerevisiae Nucleus-vacuole junction protein 1 (NVJ1) is involved in the formation of nucleus-vacuole (NV) junctions during piecemeal microautophagy of the nucleus (PMN). NV junctions are interorganelle interfaces mediated by NVJ1 in the nuclear envelope and VAC8 on the vacuole membrane. NVJ1 and VAC8 form Velcro-like patches that facilitate the pinching off of teardrop-like portions of the nucleus into the vacuolar lumen for degradation via the PMN process. NVJ1 also functions as an outer-nuclear membrane receptor for OSH1 and TSC13.

Subcellular Location
Nucleus outer membrane; Single-pass membrane protein.

Q&A

What is Nucleus-vacuole Junction Protein 1 (NVJ1) and what cellular processes is it involved in?

NVJ1 is a tether protein in Saccharomyces cerevisiae that forms and maintains stable contacts between the nuclear envelope and vacuole membrane, creating specialized microdomains called nucleus-vacuole junctions (NVJs). These junctions serve as platforms for interorganellar crosstalk and are implicated in multiple cellular processes . Accumulating evidence places NVJs at the center stage of lipid metabolism, as these junctions recruit an array of proteins involved in different aspects of lipid regulation and transfer .

NVJ1 has emerged as a strong predictor of cell fate during metabolic stress. Research has demonstrated that rapid expansion of NVJs during acute glucose starvation correlates with increased likelihood of cells entering quiescence rather than senescence . This expansion is controlled by central glucose signaling pathways, including protein kinase A (PKA) and AMP-dependent kinase Snf1, establishing a direct link between metabolic rewiring and contact site dynamics .

How should recombinant NVJ1 proteins be handled and stored for optimal stability?

Recombinant NVJ1 protein stability depends on proper handling and storage conditions. For reconstitution, the protein vial should be briefly centrifuged before opening to collect contents at the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard default concentration .

Storage temperature significantly impacts protein shelf life:

  • Liquid form: 6 months shelf life at -20°C/-80°C

  • Lyophilized form: 12 months shelf life at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week

What are the standard experimental systems used to study NVJ1 function?

Researchers employ several experimental systems to investigate NVJ1 function:

Fluorescence microscopy systems:

  • Epifluorescence microscopy with vacuole staining using CMAC dye (5 μg/mL) enables visualization of NVJ1 localization relative to the vacuole .

  • Spinning disk confocal microscopy is utilized for dynamic studies, using 63x oil immersion objectives (NA=1.4) equipped with EMCCD cameras for high-sensitivity detection .

Fluorescent protein fusion systems:

  • NVJ1-fluorescent protein chimeras (e.g., Nvj1-mNG, Nvj1-GFP) enable visualization of NVJ formation and dynamics .

  • Multi-color systems using different fluorophores (e.g., Hmg1-mRuby3 with Nvj1-mNG) allow simultaneous tracking of multiple NVJ-associated proteins .

Metabolic manipulation systems:

  • Glucose restriction/replenishment protocols trigger NVJ remodeling, with abrupt glucose restriction followed by time-lapse imaging serving as a standard approach to study NVJ dynamics during metabolic adaptation .

  • Genetic manipulation of PKA and Snf1 signaling pathways provides a system for investigating regulatory mechanisms of NVJ remodeling .

How can researchers accurately quantify NVJ1 localization and expansion?

Quantification of NVJ1 localization and expansion requires sophisticated image analysis approaches:

Fluorescence intensity ratio analysis:

  • Convert RGB images to 16-bit format

  • Perform background subtraction using Gaussian blur filtering (sigma radius = 5.0)

  • Generate five-pixel line scans across the nuclear envelope toward the NVJ

  • Use the 'plot profile' function in Fiji to produce fluorescence histograms of nuclear envelope signal

  • Calculate the sum area under each curve

  • Express results as the ratio of fluorescence intensity of NVJ-associated signal to non-NVJ associated nuclear envelope signal

This methodology enables objective quantification of the degree of NVJ1 enrichment at contact sites and allows statistical comparison between different experimental conditions.

Time-lapse analysis for dynamic studies:
For studies examining NVJ expansion kinetics during glucose starvation, multi-color time-lapse imaging combined with automated single-cell analysis provides robust quantification. This approach has been successfully used to correlate NVJ expansion with cell fate decisions (quiescence versus senescence) following metabolic stress .

What is the relationship between NVJ1 and cellular responses to glucose availability?

NVJ1 localization and NVJ expansion exhibit a dynamic relationship with glucose availability, regulated through conserved glucose signaling pathways:

During glucose depletion:

  • NVJs undergo significant expansion

  • Snd3 protein is rapidly recruited to the junctions

  • PKA signaling is inhibited

  • AMP-dependent kinase Snf1 pathway is activated

Following glucose replenishment:

  • Snd3 rapidly dissociates from the junctions

  • NVJs undergo slow disassembly

Experimental manipulation of these signaling pathways provides mechanistic insights:

  • Genetic inactivation of the inhibitory subunit of PKA (creating hyperactive PKA signaling) prevents Snd3 targeting to and Nvj1 enrichment at contact sites despite glucose depletion

  • Disruption of AMP-dependent Snf1 signaling similarly blocks Snd3 recruitment and Nvj1 enrichment

These findings establish NVJ1 as a component in the metabolic sensing machinery that helps cells adapt to changing nutrient conditions. The expansion of NVJs during glucose starvation correlates strongly with successful entry into quiescence, while senescent cells typically lack this expansion response .

How can dynamic protein interactions at NVJs be experimentally studied?

Studying dynamic protein interactions at NVJs requires specialized fluorescence techniques:

Fluorescence Recovery After Photobleaching (FRAP):

  • Cells expressing fluorescently-tagged NVJ proteins are imaged on a spinning disk confocal microscope

  • A single circular region of interest (ROI) of 0.77 μm² corresponding to the NVJ is selected

  • The ROI is bleached with a 408 nm laser (100% power, 100 ms dwell time)

  • Pre-bleach image is captured, followed by post-bleach images every 500 ms for 25 seconds

  • Recovery curves are quantified using double normalization method with the formula:
    I normalized(t) = [I frap(t)/I whole-cell(t)]/[I frap(pre)/I whole-cell(pre)]

Fluorescence Loss In Photobleaching (FLIP):

  • A circular ROI (0.77 μm²) is selected on the nuclear envelope furthest from the NVJ

  • Each bleaching cycle consists of: pre-bleach image → bleach with 408 nm laser (100 ms dwell time) → four post-bleach images taken 500 ms apart

  • 50 bleach cycles are performed for a total movie duration of 300 seconds

  • Pre-processing includes background subtraction and 3D Gaussian smoothing (sigma = 0.5)

These techniques provide quantitative measurements of protein mobility and compartmentalization, enabling researchers to determine:

  • The degree of protein confinement at NVJs

  • Exchange rates between NVJ and non-NVJ regions

  • Impacts of mutations or metabolic conditions on protein dynamics

What structural domains of NVJ1 are critical for its function in organizing nucleus-vacuole contacts?

Structural analysis of NVJ1 reveals several distinct domains with specific roles in NVJ organization:

Luminal domain:

  • Residues 25-30 of the Nvj1 luminal domain play a critical role in Hmg1 recruitment to the NVJ

  • Mutation of arginine and lysine residues at positions 28/29 to alanines (Nvj1 RK→AA) abolishes AGR-induced recruitment of Hmg1 to the NVJ

  • Deletion of residues 15-30 prevents Hmg1-mRuby3 recruitment despite NVJ formation, while deletion of only residues 15-24 preserves recruitment capacity

Transmembrane (TM) domain:

  • The TM region is interchangeable with that of Nvj2 without affecting Hmg1 recruitment

  • This suggests the TM domain functions primarily as a membrane anchor rather than having specific interaction functions

Cytoplasmic domain:

  • Remarkably, the cytoplasmic domain is not required for Hmg1 recruitment

  • A chimeric Nvj1 construct lacking its cytoplasm-exposed region and containing a vacuole-binding PX domain in place of its Vac8-binding domain (Nvj1-PX) still effectively partitions Hmg1-mRuby3 at the NVJ during glucose restriction

These findings indicate that the ER-luminal region of Nvj1 is the primary mediator of protein recruitment to NVJs, while the TM and cytoplasmic domains play more structural roles in establishing the contact site.

How does NVJ1 contribute to cellular lipid metabolism and homeostasis?

NVJ1 plays a central role in lipid metabolism through multiple mechanisms:

Recruitment of mevalonate pathway enzymes:
During glucose restriction, HMG-CoA reductase (HMGCR, encoded by HMG1 in yeast) is partitioned to the NVJ in an Nvj1-dependent manner . HMGCR is the rate-limiting enzyme in the mevalonate pathway, which produces:

  • Sterol precursors

  • Dolichol for protein glycosylation

  • Ubiquinone for respiratory chain function

  • Prenyl groups for protein modification

Spatial reorganization during metabolic stress:
The glucose restriction-driven spatial reorganization of mevalonate pathway enzymes at NVJs appears to be an adaptive response that:

  • Concentrates essential lipid biosynthetic activities

  • Potentially coordinates interorganellar lipid transfer

  • May contribute to cellular survival during metabolic stress

Link to quiescence/senescence decisions:
NVJ expansion correlates strongly with cell fate decisions. Cells that rapidly expand NVJs during acute starvation are more likely to enter quiescence and successfully regrow when nutrients are replenished . This suggests NVJ1-mediated contacts may contribute to the metabolic adaptations required for long-term survival during nutrient limitation.

What experimental approaches can be used to generate and characterize NVJ1 mutants?

Generating and characterizing NVJ1 mutants requires systematic approaches:

Generation strategies:

  • Targeted mutagenesis: Site-directed mutagenesis targeting specific residues, as demonstrated with the RK→AA mutations at positions 28/29

  • Domain deletion/swapping: Creation of truncation mutants or chimeric proteins by replacing domains with those from related proteins (e.g., Nvj1 Nvj2TM construct)

  • Fusion proteins: Generation of fluorescent protein fusions for localization studies and functional analysis

Characterization methods:

  • Localization analysis:

    • Epifluorescence and confocal microscopy to determine subcellular distribution

    • Colocalization with vacuole markers (CMAC staining) and nuclear envelope markers

  • Functional assays:

    • Quantification of NVJ expansion during glucose restriction

    • Assessment of protein recruitment to NVJs (e.g., Hmg1-mRuby3 partitioning)

  • Dynamic properties:

    • FRAP and FLIP analyses to measure protein mobility and exchange rates

    • Quantification using normalized fluorescence recovery curves

  • Physiological outcomes:

    • Cell survival following acute glucose restriction

    • Quiescence entry efficiency using cell fate predictors like Rim15 abundance

    • Regrowth capacity following nutrient replenishment

What are the optimal conditions for recombinant NVJ1 production?

Production of high-quality recombinant NVJ1 for research applications requires careful consideration of expression systems and purification protocols:

Expression systems:

  • Baculovirus expression systems have been successfully used to produce recombinant NVJ1 with high purity (>85% by SDS-PAGE)

  • This system is particularly advantageous for membrane proteins like NVJ1 as it provides eukaryotic post-translational modifications and proper folding machinery

Purification considerations:

  • Tag selection is an important consideration, as the tag type can affect protein solubility, purification efficiency, and potentially function

  • Tag type is typically determined during the manufacturing process based on optimal expression and purification outcomes

  • Partial constructs of NVJ1 may be used when full-length protein presents expression challenges

Quality control parameters:

  • Purity assessment by SDS-PAGE (target >85%)

  • Functional validation through binding assays with known interaction partners

  • Stability testing under various storage conditions

How can researchers design experiments to study NVJ1 function during metabolic stress?

Designing experiments to study NVJ1 function during metabolic stress requires careful consideration of multiple parameters:

Experimental setup for glucose restriction studies:

  • Grow yeast cultures to mid-log phase in high-glucose media

  • Transfer cells to glucose-depleted media to trigger acute starvation

  • Perform time-lapse imaging with fluorescently-tagged NVJ1 and other markers

  • Optionally replenish glucose after a defined starvation period to study recovery

  • Track individual cells throughout the experiment to correlate NVJ dynamics with cell fate

Key control conditions:

  • Genetic controls: nvj1Δ strains to confirm specificity of observed phenotypes

  • Signaling pathway manipulations: PKA hyperactivation or Snf1 pathway disruption to alter glucose signaling

  • Alternative stress conditions: Compare glucose restriction with other nutrient limitations to determine stress-specific responses

Multi-parameter analysis approach:
Wood et al. demonstrated an elegant approach using multi-color time-lapse imaging and automated single-cell analysis to monitor multiple parameters simultaneously:

  • NVJ1-fluorophore chimeras to track NVJ dynamics

  • Biomarkers for nutrient signaling (e.g., Rim15)

  • Markers for stress response and organelle homeostasis

  • Cell fate indicators to distinguish quiescence from senescence

This comprehensive approach allows researchers to correlate NVJ1 behavior with cellular outcomes and establish predictive relationships between early NVJ remodeling events and subsequent cell fate decisions.

What statistical approaches are appropriate for analyzing NVJ1 dynamics data?

Descriptive statistics:

  • Mean fluorescence intensity ratios between NVJ and non-NVJ regions

  • Standard deviation and standard error of the mean for replicate measurements

  • Coefficient of variation to assess measurement reliability

Inferential statistics:

  • Student's t-test or ANOVA for comparing NVJ1 localization under different conditions

  • Non-parametric alternatives (Mann-Whitney U test, Kruskal-Wallis test) when data do not meet normality assumptions

  • Repeated measures ANOVA for time-course experiments tracking NVJ dynamics

Advanced statistical approaches:

  • Correlation analyses to relate NVJ expansion to cell fate outcomes

  • Regression models to identify predictors of successful quiescence entry

  • Principal component analysis to integrate multiple parameters in complex datasets

Experimental design considerations:

  • Sample size determination through power analysis

  • Randomization and blinding procedures to minimize bias

  • Appropriate controls and reference standards

  • Structured approaches to experimental design and data analysis as taught in advanced research methods courses

When analyzing fluorescence recovery curves from FRAP experiments, non-linear regression fitting to exponential recovery models is typically employed to extract parameters such as mobile fraction and half-time of recovery .

What are the therapeutic potentials of recombinant S. cerevisiae expressing modified NVJ1?

While NVJ1 itself has not been directly implicated in therapeutic applications, the technology for creating recombinant S. cerevisiae expressing target proteins has significant therapeutic potential:

Immunotherapy platforms:
Whole, heat-killed recombinant S. cerevisiae has been engineered to express target proteins that stimulate immune responses against cancer cells. This platform has been used in clinical trials for patients with advanced colorectal or pancreatic cancer .

Potential NVJ1-based applications:

  • Engineered yeast with modified NVJ1 could potentially serve as research tools for studying lipid metabolism disorders

  • NVJ1's role in metabolic adaptation might inform approaches to modulate cellular responses to metabolic stress

  • Understanding NVJ biology could contribute to developing interventions for diseases involving dysregulated lipid metabolism

Safety profile:
Clinical trials with recombinant S. cerevisiae have demonstrated favorable safety profiles. In a phase 1 trial of GI-4000 (recombinant yeast expressing mutated Ras proteins), no dose-limiting toxicities were observed and no subjects discontinued treatment due to treatment-related adverse events .

While direct therapeutic applications of NVJ1 remain speculative, the established safety of recombinant yeast platforms provides a foundation for potential future development of NVJ1-related therapeutic strategies.

How might systems biology approaches enhance our understanding of NVJ1 function?

Systems biology approaches offer powerful frameworks for integrating multiple layers of data to understand NVJ1 function in the broader cellular context:

Multi-omics integration:

  • Transcriptomics: Identify gene expression changes associated with NVJ remodeling during metabolic stress

  • Proteomics: Characterize the complete protein composition of NVJs under different conditions

  • Lipidomics: Profile lipid composition changes associated with NVJ expansion

  • Metabolomics: Monitor metabolic rewiring during glucose restriction and correlate with NVJ dynamics

Network analysis:

  • Construct protein-protein interaction networks centered on NVJ1

  • Identify functional modules and pathways connected to NVJ biology

  • Map regulatory relationships between glucose signaling components and NVJ remodeling

Computational modeling:

  • Develop mathematical models of NVJ dynamics during metabolic adaptation

  • Simulate effects of perturbations to predict system behavior

  • Integrate spatial and temporal dimensions to understand NVJ remodeling kinetics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.