Recombinant Saccharomyces cerevisiae Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of PFA4

PFA4 is encoded by the PFA4 gene (Entrez Gene ID: 854159) in Saccharomyces cerevisiae S288C. Key features include:

PropertyDetail
Gene SymbolPFA4
Full NamePalmitoyltransferase PFA4
OrganismSaccharomyces cerevisiae S288C
mRNA AccessionNM_001183257.1
Protein AccessionNP_014640.1
Gene TypeProtein-coding
Catalytic DomainDHHC motif (critical for palmitoyltransferase activity)

The recombinant form is typically expressed using cDNA ORF clones, such as the pcDNA3.1+/C-(K)DYK vector system, to enable functional studies .

Biochemical Function and Mechanism

PFA4 mediates S-palmitoylation, a lipid modification that anchors target proteins to membranes. Key mechanistic insights include:

  • Catalytic Activity: Mutation of the DHHC motif (e.g., C108A) abolishes enzymatic activity, confirming its role in palmitoylation .

  • Subcellular Localization: PFA4 resides in the endoplasmic reticulum (ER) membrane, with its catalytic domain facing the cytoplasm .

  • Role in ER Quality Control: PFA4 ensures proper folding and ER export of polytopic membrane proteins like Chs3 by preventing aggregation .

Substrates and Functional Targets

PFA4 exhibits substrate specificity for proteins involved in diverse cellular processes:

SubstrateFunctionBiological Impact
Chs3 (Chitin Synthase)Cell wall chitin synthesisER export and membrane localization
Rif1Telomere regulation, heterochromatin dynamicsNuclear membrane anchoring and silencing
Ras1 (in C. neoformans)Signal transduction, virulenceMembrane localization, thermotolerance

Key Findings:

  • Chs3 Palmitoylation: PFA4-dependent palmitoylation of Chs3 is essential for its ER export. In pfa4Δ mutants, Chs3 accumulates in ER aggregates, impairing cell wall integrity .

  • Rif1 Modification: PFA4 palmitoylates Rif1, anchoring it to the nuclear membrane to regulate heterochromatin formation at HMR and HML loci .

  • Cross-Species Roles: In Cryptococcus neoformans, Pfa4 is critical for Ras1 palmitoylation, affecting virulence and thermotolerance .

Research Applications and Implications

  • Model for Protein Trafficking: Recombinant PFA4 is used to study ER export mechanisms of polytopic membrane proteins .

  • Heterochromatin Dynamics: PFA4’s role in Rif1 modification provides insights into nuclear architecture and gene silencing .

  • Antifungal Target Exploration: While studied in S. cerevisiae, PFA4 homologs in pathogens like C. neoformans are implicated in virulence, highlighting potential therapeutic targets .

Comparative Analysis with Other PATs

PFA4 differs from other yeast palmitoyltransferases in substrate specificity and localization:

PATSubstratesLocalizationKey Role
Pfa4Chs3, Rif1, Ras1ER membraneER export, heterochromatin
Erf2/Erf4Ras2ER membraneRas signaling
Akr1Casein kinase Yck2Golgi/endosomesMembrane trafficking

Future Directions

  • Structural Studies: High-resolution crystallography of PFA4 could elucidate substrate recognition mechanisms.

  • Broad-Spectrum Screening: Identifying additional PFA4 substrates in S. cerevisiae may reveal novel roles in stress response or metabolism.

  • Therapeutic Exploitation: Targeting PFA4 homologs in fungal pathogens could disrupt virulence pathways without affecting human PATs .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for prioritized development.
Synonyms
PFA4; YOL003C; UNE378; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PFA4
Target Protein Sequence
MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW YNDWGESLDDFGVDVDME
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Palmitoyltransferase PFA4 (PFA4) mediates the reversible addition of palmitate to target proteins, thus regulating their membrane association and biological function. It palmitoylates several amino acid permeases and chitin synthase CHS3 (essential for its ER export). In vitro palmitoylation of RAS2 has also been observed.
Gene References Into Functions
  1. Our findings demonstrate that Chs3 undergoes palmitoylation, a process dependent on Pfa4, confirming Pfa4's role as a protein acyl transferase. PMID: 16818716
Database Links

KEGG: sce:YOL003C

STRING: 4932.YOL003C

Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How does the palmitoylation of Rif1 by PFA4 affect nuclear dynamics?

The palmitoylation of Rif1 by PFA4 profoundly impacts nuclear dynamics, particularly regarding the spatial organization of heterochromatin and telomere clusters within the nucleus. This post-translational modification creates a layer of regulation that influences the three-dimensional architecture of the genome.

The altered distribution of Rif1 subsequently affects other heterochromatin proteins. Sir3-GFP distribution is also perturbed in pfa4Δ mutants, with the number of Sir3-GFP foci decreasing from an average of 8.8 in wild-type cells to 7.0 in pfa4Δ mutants . Similar effects are observed in rif1Δ mutants (7.4 Sir3-GFP foci per nucleus) and rif1Δ pfa4Δ double mutants (~7 foci per nucleus) . The similarity between single and double mutants suggests that PFA4 and RIF1 act in a common pathway to modulate telomere clustering .

GenotypeAverage Sir3-GFP Foci per NucleusRif1-GFP Distribution
Wild-type8.810-12 discrete peripheral foci
pfa4Δ7.02-4 diffuse nucleoplasmic foci
rif1Δ7.4N/A
rif1Δ pfa4Δ~7.0N/A
  • What are the distinct features of PFA4 catalytic mechanism compared to other DHHC palmitoyltransferases?

PFA4 exhibits several distinctive features in its catalytic mechanism that set it apart from most other DHHC palmitoyltransferases:

The most notable distinction is PFA4's unusual cysteine independence. While the cysteine residue in the DHHC motif is typically essential for the activity of most palmitoyltransferases, PFA4 can still function when this cysteine (C108) is mutated to arginine or alanine . This rare property is shared only with another yeast PAT, Swf1 . Most DHHC enzymes undergo autopalmitoylation at the DHHC cysteine as part of their catalytic cycle, but the fact that PFA4 can function without this residue suggests it may employ an alternative mechanism for acyl transfer.

Research suggests that it might be possible for PATs like PFA4 to be acylated in trans (by another enzyme), which could explain how it functions without the canonical DHHC cysteine . This mechanism represents a significant deviation from the standard model of DHHC enzyme function and highlights the potential diversity of catalytic strategies within this enzyme family.

Despite this cysteine independence, the catalytic activity of PFA4 is still required for its biological functions. A pfa4C108A mutation creates a catalytically inactive version that fails to complement silencing defects in pfa4Δ mutants or direct the trafficking of substrates like chitin synthase . This paradox—that C108 can be mutated while preserving some function, yet is still important for catalytic activity—suggests a complex catalytic mechanism that may involve multiple residues or alternative catalytic pathways.

Like other DHHC enzymes, PFA4 contains a PaCCT (Palmitoyltransferase Conserved C-Terminus) motif that contributes to enzyme function . In related enzymes, specific residues within this motif have been shown to be critical for activity, such as phenylalanine 250 in the yeast PAT Pfa3, which when mutated to alanine diminishes function .

  • What experimental approaches can be used to identify novel substrates of PFA4?

Identifying novel substrates of PFA4 requires a multi-faceted experimental strategy combining proteomic, genetic, and cellular approaches:

The acyl-biotin exchange (ABE) protocol, used successfully to identify Rif1 as a PFA4 substrate, represents a powerful biochemical approach . This method involves protecting free thiols with N-ethylmaleimide (NEM), cleaving thioester bonds with hydroxylamine, and then specifically biotinylating the newly liberated thiols. Biotinylated proteins can then be purified by neutravidin-affinity chromatography and identified by mass spectrometry . Comparing samples from wild-type and pfa4Δ strains allows for the identification of PFA4-dependent palmitoylation. Critical controls include the omission of hydroxylamine to verify thioester linkage specificity and the use of known substrates (like GNP1-3xHA) as positive controls .

A complementary approach involves fluorescence microscopy to identify proteins whose localization changes in pfa4Δ mutants. Since PFA4-dependent palmitoylation anchors proteins to membranes, the loss of this modification often results in protein relocalization. Creating a library of GFP-fusion proteins and comparing their localization in wild-type versus pfa4Δ strains could identify candidates that, like Rif1-GFP, disperse from the nuclear periphery in the absence of PFA4 . Additional validation could come from testing whether the catalytically inactive pfa4C108A mutant produces similar localization changes .

Genetic approaches provide another avenue for substrate identification. Screening for genes that, when deleted, phenocopy specific aspects of the pfa4Δ phenotype (such as reduced HMR silencing) could identify potential substrates or pathway components . Epistasis analysis, as demonstrated with PFA4 and RIF1, can help establish pathway relationships .

ApproachMethodologyAdvantagesLimitations
Acyl-biotin exchange (ABE)Biochemical isolation of palmitoylated proteinsDirect identification of modified proteinsMay miss low-abundance substrates
Proteomic comparisonMS analysis of wild-type vs pfa4Δ palmitoylomesComprehensive, unbiasedRequires sophisticated MS equipment
Localization screeningGFP-fusion library in wild-type vs pfa4ΔFunctional readoutLabor-intensive, may miss subtle changes
Genetic screeningIdentify mutants with pfa4Δ-like phenotypesLinks to biological functionIndirect, affected by redundancy
Candidate approachTest predicted palmitoylation sitesFocused, hypothesis-drivenLimited by prediction accuracy

For candidates identified through these approaches, validation should include site-directed mutagenesis of cysteine residues to confirm palmitoylation sites, rescue experiments with wild-type versus catalytically inactive PFA4, and functional assays to assess the biological relevance of the modification.

  • How does the PFA4-Rif1 pathway interact with other silencing mechanisms?

The PFA4-Rif1 pathway interacts with several other silencing mechanisms in Saccharomyces cerevisiae, creating a complex regulatory network for heterochromatin formation:

PFA4 also contributes to FKH1-assisted silencing, a SIR1-independent mechanism that is "likely to be more conserved in eukaryotes" . In this context, a1 mRNA levels increase twofold in pfa4Δ mutants compared to wild-type cells . This indicates that PFA4 works cooperatively with FKH1 to establish or maintain heterochromatin in a manner distinct from the classical SIR pathway.

At the molecular level, the PFA4-Rif1 pathway influences Sir3 localization and dynamics. Sir3-GFP distribution is altered in pfa4Δ mutants, with the number of Sir3-GFP foci decreasing from 8.8 in wild-type cells to 7.0 in mutants . This suggests that the PFA4-Rif1 pathway affects silencing in part by modulating the distribution or stability of Sir proteins at heterochromatic regions, creating an intersection between different silencing mechanisms.

Interestingly, despite the clear role of PFA4 in HM silencing, it has "surprisingly mild effects on telomeric regulation" . This differential impact suggests that the PFA4-Rif1 pathway has context-specific interactions with other silencing mechanisms, with stronger effects at HM loci than at telomeres. This observation challenges the simplified view of heterochromatin regulation and indicates "Rif1's roles at HM loci and telomeres were more complexly related than previously thought" .

  • What are the implications of PFA4-dependent palmitoylation for chromosome biology?

The implications of PFA4-dependent palmitoylation for chromosome biology are far-reaching and multifaceted, revealing a novel layer of regulation in nuclear organization and gene expression:

PFA4-dependent palmitoylation establishes a direct link between post-translational lipid modifications and heterochromatin formation. By enhancing heterochromatin at the cryptic mating-type loci HMR and HML through Rif1 palmitoylation, PFA4 demonstrates how membrane-associated modifications can influence chromatin states . This is evidenced by reduced Sir3 levels at HMR (more than twofold) and increased transcription of the a1 gene in pfa4Δ mutants .

The anchoring of Rif1 to the nuclear periphery through palmitoylation contributes significantly to nuclear architecture and chromosome positioning . The dispersal of Rif1 in pfa4Δ mutants suggests that palmitoylation helps maintain specific chromosomal regions at the nuclear periphery, which is often associated with transcriptional repression . This mechanism adds to our understanding of how the three-dimensional organization of chromosomes within the nucleus influences gene expression.

PFA4-dependent palmitoylation provides a dynamic regulatory mechanism due to the reversible nature of this modification . Unlike some permanent modifications, palmitoylation can be removed by depalmitoylating enzymes, potentially allowing for responsive changes in chromosome organization during different cellular processes or cell cycle stages. This reversibility could be crucial for adaptable gene regulation in changing environmental conditions.

The differential effects of PFA4 on HM silencing versus telomeric regulation highlight the complexity of chromosome domain regulation . This suggests that different heterochromatic regions may rely on distinct regulatory mechanisms or combinations of mechanisms, with PFA4-dependent palmitoylation playing varying roles depending on the genomic context.

The epistatic relationship between PFA4 and RIF1, as demonstrated by the similar effects of single and double mutations on Sir3-GFP foci numbers, positions palmitoylation as an upstream regulatory mechanism in chromosome biology pathways . This hierarchical arrangement helps clarify how post-translational modifications feed into larger-scale chromosome organizational processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.