Recombinant Saccharomyces cerevisiae Peptidyl-prolyl cis-trans isomerase CPR4 (CPR4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
CPR4; CYP4; SCC3; YCR069W; YCR69W/YCR70W; Peptidyl-prolyl cis-trans isomerase CPR4; PPIase CPR4; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-318
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
CPR4
Target Protein Sequence
APSSGKQITSKDVDLQKKYEPSPPATHRGIITIEYFDPVSKSMKEADLTFELYGTVVPKT VNNFAMLAHGVKAVIEGKDPNDIHTYSYRKTKINKVYPNKYIQGGVVAPDVGPFTVYGPK FDDENFYLKHDRPERLAMAYFGPDSNTSEFIITTKADGNEELDGKSVVFGQITSGLDQLM DAIQYTETDEYGKPQHELRFLYFVLEILKISNILDLHAAYTEKVEKFRNGDVSVGSTLEN IFRNDKAYTPLTTSTGTTAYDLNHPISRALMCLTVLGLCFIAYKGMHEKPHTVSLRHK
Uniprot No.

Target Background

Function
Peptidyl-prolyl cis-trans isomerases (PPIases) accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Gene References Into Functions
  1. Scc3 and Pds5 are cohesin maintenance factors crucial for cohesin ring stability and/or its association with DNA. PMID: 22912589
Database Links

KEGG: sce:YCR069W

STRING: 4932.YCR069W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Peptidyl-prolyl cis-trans isomerase CPR4?

Saccharomyces cerevisiae Peptidyl-prolyl cis-trans isomerase CPR4 (UniProt ID: P25334/CYPR_YEAST) is a member of the cyclophilin family of proteins that catalyzes the cis-trans isomerization of peptide bonds at proline residues. CPR4 contains a single cyclophilin-like domain (CLD) plus a long amino-terminal signal peptide . It is encoded by the CPR4 gene (also known as CYP4 or SCC3) in Saccharomyces cerevisiae and is one of eight cyclophilins (Cpr1-8) identified in yeast . As a peptidyl-prolyl isomerase, CPR4 plays roles in protein folding, trafficking, and cellular signaling pathways. The protein is characterized as a precursor, suggesting post-translational processing is required for its maturation and full functionality in cellular environments.

Where is CPR4 localized in the yeast cell?

CPR4 has been characterized as a vacuolar protein in Saccharomyces cerevisiae. Research has demonstrated that CPR4 contains a long amino-terminal signal peptide that directs the protein to vacuoles within the yeast cell . This vacuolar localization differs from other yeast cyclophilins: Cpr1 is found in both cytoplasm and nuclei; Cpr2 and Cpr5 are directed to the endoplasmic reticulum (ER); Cpr3 is localized to mitochondria; Cpr8 is also found in vacuoles like CPR4; while Cpr6 and Cpr7 are associated with heat-shock proteins and other protein chaperones . The specific vacuolar localization suggests CPR4 may be involved in protein processing, degradation, or other vacuolar functions that differ from cyclophilins found in other cellular compartments.

What structural elements characterize CPR4?

CPR4 possesses a distinct structural organization characterized by:

  • A single cyclophilin-like domain (CLD) that contains the peptidyl-prolyl cis-trans isomerase activity site

  • A long amino-terminal signal peptide that directs the protein to vacuoles

  • Classification as a precursor protein, indicating post-translational processing

While detailed structural information specific to CPR4 is limited in the provided search results, we can draw comparisons with other cyclophilins. Cyclophilins typically exhibit characteristic spectroscopic properties when properly folded, including negative minima at 222 and 208 nm in far-UV circular dichroism (CD) spectra representing α-helical structures, as observed with the related peptidyl-prolyl cis/trans-isomerase Rrd1 . The protein is likely to maintain a well-defined tertiary structure under physiological conditions that can be detected through fluorescence spectroscopy .

How does CPR4 differ from other cyclophilins in yeast?

CPR4 has several distinguishing features compared to other yeast cyclophilins:

CyclophilinKey CharacteristicsCellular Localization
CPR4 (CYP4)Single CLD domain with long amino-terminal signal peptideVacuoles
Cpr1Homolog of human CypA with 65% sequence identityCytoplasm and nuclei
Cpr2Contains amino-terminal signal peptideEndoplasmic reticulum
Cpr3Contains amino-terminal signal peptideMitochondria
Cpr5Contains amino-terminal signal peptideEndoplasmic reticulum
Cpr6Contains carboxy-terminal TPR repeatsAssociates with heat-shock proteins
Cpr7Contains carboxy-terminal TPR repeatsAssociates with heat-shock proteins
Cpr8Single CLD domain with long amino-terminal signal peptideVacuoles

CPR4 shares the most similarity with Cpr8, as both contain a single CLD domain with a long amino-terminal signal peptide and are localized to vacuoles . This distinct localization pattern suggests specialized functions within the vacuolar environment, potentially related to protein processing or degradation pathways that differ from the functions of cyclophilins in other cellular compartments.

What are the main functions of peptidyl-prolyl cis-trans isomerases in yeast?

Peptidyl-prolyl cis-trans isomerases (PPIases) in yeast, including CPR4, perform several critical cellular functions:

  • Protein folding assistance: They catalyze the isomerization of peptide bonds preceding proline residues, which is often a rate-limiting step in protein folding.

  • Stress response: Many cyclophilins are involved in cellular responses to various stressors. For example, some yeast cyclophilins like Cpr1 can form complexes with cyclosporin A to inhibit calcineurin, preventing recovery from pheromone-induced growth arrest .

  • Signaling pathways: They participate in signal transduction pathways, often through interaction with other proteins.

  • Chaperoning activities: Some cyclophilins, particularly those with additional domains like Cpr6 and Cpr7, associate with heat-shock proteins and function as chaperones in protein assembly and maintenance .

  • Protein trafficking: PPIases can facilitate protein translocation across membranes and proper localization within the cell.

While the specific functions of CPR4 are not extensively detailed in the provided search results, its vacuolar localization suggests potential roles in protein processing, degradation pathways, or vacuolar enzyme regulation that would be distinct from cyclophilins located in other cellular compartments.

What are the optimal conditions for recombinant expression of CPR4?

While the search results don't specifically address CPR4 expression, we can draw methodological approaches from similar recombinant protein expression systems used for related peptidyl-prolyl isomerases in yeast:

  • Expression vector selection: A bacteriophage T7 inducible promoter system coupled with a lac operator, such as the pET21d(+) vector used for Rrd1 expression, provides strong and controllable expression . For yeast-specific expression, vectors with strong constitutive promoters like GPD (glyceraldehyde-3-phosphate dehydrogenase) have proven effective for other recombinant proteins .

  • Host strain optimization: For E. coli expression, BL21(DE3) strains are commonly used for T7-based expression systems. For expression within yeast, minimally engineered strains like BY4741 can serve as effective hosts .

  • Induction conditions: IPTG induction at concentrations of 0.5-1.0 mM when cultures reach mid-log phase (OD600 of 0.6-0.8) typically yields optimal expression for T7-based systems.

  • Growth temperature: Post-induction growth at lower temperatures (16-20°C) often improves protein solubility for recombinant expression of yeast proteins.

  • Affinity tag selection: A C-terminal His-tag facilitates purification while typically maintaining enzyme function, as demonstrated with similar proteins .

  • Codon optimization: For heterologous expression, codon optimization for the host organism can significantly improve translation efficiency and protein yield, as demonstrated with other yeast proteins .

When expressing CPR4, researchers should consider its vacuolar targeting sequence, which may affect solubility or require modification for optimal cytoplasmic expression in bacterial systems.

What purification strategies are most effective for recombinant CPR4?

Based on successful purification approaches for related yeast peptidyl-prolyl isomerases, the following multi-step purification strategy would likely be effective for recombinant CPR4:

  • Immobilized Metal Affinity Chromatography (IMAC): If expressed with a histidine tag, IMAC using Ni-NTA or Co-NTA resins provides an effective first purification step. This approach has been successfully employed for the similar peptidyl-prolyl cis/trans-isomerase Rrd1 . Typical conditions include:

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20-40 mM imidazole

    • Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250-500 mM imidazole

  • Size Exclusion Chromatography (SEC): Following IMAC, SEC provides further purification while simultaneously offering insights into the oligomeric state of the protein. For instance, SEC analysis of Rrd1 revealed it exists primarily as a monomer in solution . Suitable columns include Superdex 75 or Superdex 200, with typical running buffer consisting of 50 mM Tris-HCl pH 7.5, 150 mM NaCl.

  • Validation of homogeneity: Western blotting using antibodies specific to the protein or the affinity tag can confirm the identity and purity of the isolated protein .

  • Activity-based purification: For functional studies, an additional purification step based on enzymatic activity might be considered, particularly if contaminating proteins remain after IMAC and SEC.

  • Buffer optimization: Since CPR4 is normally localized to vacuoles, consideration of pH conditions that mimic this environment (typically pH 5.5-6.5) may be important for maintaining proper folding and activity during purification.

The purification protocol should be tailored to maintain the native folding and activity of CPR4, with careful attention to buffer components that stabilize the protein structure.

What techniques are most effective for characterizing CPR4 structure and function?

Several complementary techniques can effectively characterize the structure and function of recombinant CPR4:

  • Circular Dichroism (CD) Spectroscopy: Far-UV CD can assess secondary structure elements, with properly folded peptidyl-prolyl isomerases typically showing characteristic negative minima at 222 and 208 nm, indicating α-helical content . Near-UV CD provides information about tertiary structure.

  • Fluorescence Spectroscopy: Intrinsic fluorescence from aromatic residues (tryptophan, tyrosine) can reveal information about the tertiary structure and folding state of CPR4 .

  • Enzymatic Activity Assays: Peptidyl-prolyl isomerase activity can be measured using:

    • Coupled enzyme assays monitoring NADH consumption with spectrophotometry at 340 nm

    • Protease-coupled assays using chromogenic or fluorogenic peptide substrates

    • NMR-based assays that directly monitor cis-trans isomerization

  • Protein-Protein Interaction Studies:

    • Pull-down assays to identify binding partners

    • Surface Plasmon Resonance (SPR) to determine binding kinetics

    • Yeast two-hybrid screening to identify novel interactors

  • Structural Analysis:

    • X-ray crystallography for high-resolution structural determination, facilitated by protein abundance achieved through recombinant expression

    • Small-angle X-ray scattering (SAXS) for solution-state structural information

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe structural dynamics

  • Comparative Analysis Methods: Protein Interaction Property Similarity Analysis (PIPSA) can identify CPR4 from different species using a computational fingerprint based on molecular interaction properties .

  • Kinetic Analysis: Determining kinetic parameters (Km, kcat, kcat/Km) using varying substrate concentrations (25-500 mM for similar enzymes) provides insights into catalytic efficiency .

These complementary approaches provide a comprehensive characterization of CPR4's structure-function relationships and can reveal insights into its specific cellular roles.

How can directed evolution be applied to optimize CPR4 function?

Directed evolution can be a powerful approach for optimizing CPR4 function for various research applications. Based on successful directed evolution of other yeast enzymes, the following methodology could be applied:

  • Library Creation:

    • Error-prone PCR using a kit such as GeneMorph II Random Mutagenesis Kit to create libraries with varying mutation rates (low: 0-4.5 mutations/kb, medium: 4.5-9 mutations/kb, high: 9-16 mutations/kb)

    • Design primers with appropriate restriction sites for subsequent cloning

    • Create libraries of approximately 10^5 members to ensure good coverage of potential beneficial mutations

  • Expression Vector Construction:

    • Clone the mutagenized CPR4 gene into a yeast expression vector with a strong promoter (e.g., GPD promoter)

    • Include appropriate selection markers for screening in yeast

  • Transformation and Library Screening:

    • Transform the library into a suitable yeast strain (e.g., BY4741 or a strain engineered for the specific screening condition)

    • Develop a growth-based selection system where improved CPR4 function confers a growth advantage

    • Use serial transfers in selective media to enrich for variants with improved function

  • Variant Isolation and Characterization:

    • Plate enriched cultures and select colonies showing desired phenotypes

    • Isolate plasmids from promising candidates and sequence to identify mutations

    • Retransform purified plasmids to confirm that improved phenotypes are plasmid-dependent and not due to host adaptation

  • Iterative Improvement:

    • Use the best-performing variant as the template for subsequent rounds of mutagenesis and selection

    • Repeat the process for multiple rounds to accumulate beneficial mutations

    • Consider reducing the number of serial transfers in later rounds as variants become more optimized

  • Biochemical Characterization:

    • Measure enzyme kinetics to quantify improvements in catalytic efficiency

    • Assess protein stability under various conditions

    • Determine structure-function relationships of beneficial mutations

This approach has successfully improved other yeast enzymes, such as xylose isomerase, which gained a 77% increase in enzymatic activity after three rounds of directed evolution incorporating six beneficial mutations .

What are the challenges in crystallizing CPR4 for structural studies?

Crystallizing CPR4 for structural studies presents several challenges that researchers should address methodically:

  • Protein Purity and Homogeneity:

    • CPR4 must be purified to >95% homogeneity to maximize crystallization success

    • Size exclusion chromatography is essential to ensure monodispersity of the sample

    • Western blotting can confirm the absence of contaminating proteins or degradation products

  • Protein Stability and Solubility:

    • The presence of the vacuolar targeting signal peptide may affect solubility and requires consideration

    • Truncation constructs removing the signal peptide might improve crystallization prospects

    • Buffer optimization is critical to maintain stability during concentration and crystallization

  • Post-translational Modifications:

    • As a precursor protein, CPR4 may undergo processing that affects structural homogeneity

    • Expression in different systems (bacterial vs. yeast) may result in different modification patterns

    • Mass spectrometry should be employed to characterize any modifications

  • Construct Design:

    • Multiple constructs with different boundaries should be tested

    • Surface entropy reduction (SER) through mutation of surface-exposed high-entropy residues (Lys, Glu) to alanine may improve crystal contacts

    • Fusion partners like T4 lysozyme or MBP might facilitate crystallization

  • Crystallization Conditions:

    • Extensive screening of crystallization conditions with commercial screens

    • Optimization of promising conditions by varying pH, precipitant concentration, and additives

    • Consideration of vacuolar pH conditions (typically more acidic) in crystallization trials

  • Crystal Quality Assessment:

    • Rigorous evaluation of diffraction quality at synchrotron sources

    • Implementation of post-crystallization treatments to improve diffraction quality

    • Consideration of alternative crystallization methods (lipidic cubic phase, microseeding) if initial trials fail

Successful crystallization of CPR4 would significantly advance our understanding of its structural basis of function, potentially revealing insights into substrate specificity and interaction surfaces. The abundance achieved through recombinant expression specifically enhances the prospects for successful crystallization studies .

How can one assess the impact of post-translational modifications on CPR4 activity?

Investigating the impact of post-translational modifications (PTMs) on CPR4 activity requires a systematic approach combining various analytical and functional techniques:

  • Identification of PTMs:

    • Mass spectrometry (MS) techniques including LC-MS/MS for comprehensive mapping of PTMs

    • Enrichment strategies for specific modifications (e.g., phosphopeptide enrichment using TiO2 or IMAC)

    • Western blotting with modification-specific antibodies (phospho-, acetyl-, ubiquitin-specific)

    • Comparison of CPR4 expressed in different systems (bacterial versus yeast) to identify host-specific modifications

  • Site-directed mutagenesis approaches:

    • Generate point mutations at identified or predicted modification sites (e.g., Ser/Thr→Ala for phosphorylation sites)

    • Create phosphomimetic mutations (Ser/Thr→Asp/Glu) to simulate constitutive phosphorylation

    • Express and purify mutant proteins using established protocols

  • Functional assays to assess impact of modifications:

    • Compare peptidyl-prolyl isomerase activity between wild-type and mutant proteins

    • Determine enzyme kinetic parameters (Km, kcat, kcat/Km) for different substrates

    • Assess protein stability using thermal shift assays or circular dichroism spectroscopy

    • Evaluate protein-protein interactions with known binding partners

  • In vivo approaches:

    • Express wild-type and mutant versions of CPR4 in yeast strains

    • Assess complementation of CPR4 deletion phenotypes

    • Monitor CPR4 localization using fluorescent protein fusions

    • Evaluate responses to various stressors or signaling molecules

  • Specific considerations for ubiquitination studies:

    • Yeast ubiquitination status is known to be regulated during cell growth for related proteins

    • Investigation of E3 ligases such as Not4p, which regulates ubiquitination of other yeast proteins

    • Analysis of ubiquitination patterns under different growth conditions or stress responses

  • Structural impact assessment:

    • Compare CD spectra and fluorescence profiles of modified and unmodified proteins

    • Molecular dynamics simulations to predict structural changes induced by modifications

    • HDX-MS to identify regions with altered conformational dynamics due to modifications

This comprehensive approach will provide insights into how PTMs regulate CPR4 function, potentially revealing mechanisms for spatial and temporal control of its activity within the vacuolar environment.

What genetic approaches can be used to study CPR4 function in vivo?

Genetic approaches provide powerful tools for investigating CPR4 function in its native cellular context:

  • Gene Deletion and Complementation Studies:

    • Create CPR4 deletion strains (cpr4Δ) using homologous recombination-based techniques

    • Assess phenotypic consequences under various growth conditions, stress responses, and cellular processes

    • Complement deletions with wild-type or mutant CPR4 variants to verify specificity

    • Perform growth-based assays to quantify changes in cellular fitness

  • Conditional Expression Systems:

    • Implement regulatable promoters (e.g., GAL1, MET25, or tetracycline-responsive) to control CPR4 expression

    • Create degron-tagged CPR4 for rapid protein depletion

    • Perform time-course studies following induction or repression to identify immediate consequences of CPR4 activity changes

  • Genetic Interaction Mapping:

    • Perform synthetic genetic array (SGA) analysis with cpr4Δ to identify genetic interactions

    • Construct double mutants with genes involved in protein folding, trafficking, or vacuolar function

    • Apply chemical-genetic profiling to identify conditions where CPR4 becomes essential

    • Analyze genetic interactions with other cyclophilin family members to identify redundant or specialized functions

  • High-throughput Phenotypic Profiling:

    • Subject cpr4Δ strains to diverse growth conditions, chemical stresses, and nutrient limitations

    • Implement barcode-based pooled screening approaches for competitive fitness measurements

    • Use flow cytometry-based reporters to monitor stress responses or protein homeostasis

  • Protein Localization and Dynamics:

    • Generate fluorescent protein fusions to monitor CPR4 localization, ensuring vacuolar targeting is maintained

    • Apply photobleaching techniques (FRAP, FLIP) to study protein mobility and turnover

    • Implement proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to CPR4 in vivo

  • Domain Function Analysis:

    • Generate domain deletion or point mutation variants to assess the contribution of specific regions

    • Create chimeric proteins by swapping domains between CPR4 and other yeast cyclophilins to identify determinants of vacuolar localization and function

    • Express only the catalytic domain to determine if localization affects function

  • Response to Environmental Conditions:

    • Monitor changes in CPR4 expression, localization, or modification under various stress conditions

    • Investigate the role of CPR4 in rapamycin response pathways, as other cyclophilins are implicated in these processes

These genetic approaches can be combined with biochemical and cell biological methods to develop a comprehensive understanding of CPR4's cellular functions and its specific contributions to vacuolar processes in yeast.

How can protein-protein interaction networks of CPR4 be mapped effectively?

Mapping the protein-protein interaction (PPI) network of CPR4 requires a multi-faceted approach combining complementary techniques:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express epitope-tagged CPR4 (e.g., TAP-tag, FLAG-tag, or HA-tag) in yeast

    • Perform gentle lysis to preserve physiologically relevant interactions

    • Isolate CPR4 complexes using appropriate affinity matrices

    • Identify interacting partners through mass spectrometry analysis

    • Include appropriate controls (untagged strains, irrelevant tagged proteins) to filter out non-specific interactions

    • Consider crosslinking approaches to capture transient interactions

  • Proximity-Based Labeling Methods:

    • Fuse CPR4 to enzymes like BioID, TurboID, or APEX2

    • Allow in vivo labeling of proximal proteins

    • Purify biotinylated proteins using streptavidin-based methods

    • Identify labeled proteins by mass spectrometry

    • This approach is particularly valuable for membrane-associated or compartmentalized proteins like vacuolar CPR4

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use CPR4 as bait to screen against yeast genomic or cDNA libraries

    • Consider membrane Y2H variants for proteins with transmembrane domains

    • Validate interactions using orthogonal methods

    • Test directed interactions with proteins involved in vacuolar function

  • Protein Complementation Assays:

    • Split-GFP, split-luciferase, or split-ubiquitin systems to detect direct interactions

    • Express CPR4 fused to one fragment and potential interactors fused to complementary fragments

    • Monitor for reconstitution of reporter activity indicating interaction

    • These assays can visualize the subcellular localization of interactions within living cells

  • Protein Microarray Analysis:

    • Purify recombinant CPR4 and probe against proteome-wide arrays

    • Test for interactions with specific protein families of interest

    • Analyze for substrate preferences among different proteins

  • Computational Prediction and Network Analysis:

    • Apply PIPSA analysis to identify potential interaction partners based on similar interaction properties

    • Integrate experimental data with existing databases and predicted interactions

    • Construct functional networks connecting CPR4 to cellular pathways

    • Prioritize interactions for experimental validation

  • Focused Validation Studies:

    • Confirm key interactions using biophysical methods like Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC)

    • Determine binding affinities and kinetics for important interactions

    • Map interaction domains through deletion or mutation analysis

    • Assess the effect of PTMs on interaction profiles

  • Physiological Relevance Assessment:

    • Investigate how identified interactions change under different physiological conditions

    • Determine if interactions are regulated by stress, cell cycle, or other stimuli

    • Test the functional consequences of disrupting specific interactions

This comprehensive approach would generate a detailed interaction map of CPR4, providing insights into its functional roles within vacuolar and cellular pathways, while identifying potential binding partners and substrates relevant to its peptidyl-prolyl isomerase activity.

How does CPR4 compare functionally to cyclophilins in other organisms?

A comparative analysis of CPR4 with cyclophilins from other organisms reveals both conservation and specialization of function:

This comparative analysis highlights CPR4's specialized role within the broader cyclophilin family, with its vacuolar localization suggesting adaptation to specific functions within yeast cells that may differ from those of cyclophilins in other cellular compartments or organisms.

What methodologies can be used to study the substrate specificity of CPR4?

Understanding the substrate specificity of CPR4 requires a combination of biochemical, computational, and high-throughput approaches:

  • Peptide Library Screening:

    • Screen combinatorial peptide libraries containing diverse proline-containing sequences

    • Use spectrophotometric assays to measure isomerization rates for different substrates

    • Identify sequence motifs that promote CPR4 binding and catalysis

    • Compare substrate preferences with other yeast cyclophilins to identify unique specificities

  • Proteomic Identification of Substrates:

    • Apply stable isotope labeling with amino acids in cell culture (SILAC) in wild-type versus cpr4Δ strains

    • Identify proteins with altered folding or stability in the absence of CPR4

    • Analyze enriched sequence motifs surrounding proline residues in potential substrates

    • Focus particularly on vacuolar proteins given CPR4's localization

  • Computational Prediction Methods:

    • Develop machine learning algorithms trained on known cyclophilin substrates

    • Predict potential CPR4 substrates based on sequence, structure, and localization

    • Apply molecular docking simulations to evaluate binding of candidate substrate peptides

    • Use PIPSA analysis to compare interaction properties with other known peptidyl-prolyl isomerases

  • Structure-Based Approaches:

    • If structural data becomes available, analyze the substrate binding pocket

    • Perform structure-guided mutagenesis of residues in the catalytic site

    • Analyze the impact of mutations on substrate preference profiles

    • Compare structural features with other cyclophilins having different specificities

  • In Vitro Enzymatic Assays:

    • Measure enzymatic parameters (Km, kcat, kcat/Km) for various model substrates

    • Test different concentration ranges (e.g., 25-500 mM) of potential substrates to determine kinetic parameters

    • Assess the impact of buffer conditions, pH, and ionic strength on substrate specificity

    • Develop novel fluorescence-based or NMR-based assays for direct measurement of cis-trans isomerization

  • Protein Microarray Screening:

    • Apply purified CPR4 to protein microarrays to identify binding partners

    • Validate binding through secondary assays

    • Test whether binding correlates with isomerization activity

    • Compare binding profiles with other cyclophilins

  • Targeted Validation Studies:

    • Express and purify candidate substrate proteins

    • Directly measure isomerization rates of specific proline residues

    • Generate proline-to-alanine mutations to confirm specific residues targeted by CPR4

    • Assess functional consequences of disrupting CPR4-mediated isomerization

These complementary approaches would provide a comprehensive view of CPR4's substrate specificity, potentially revealing its specialized functions within the vacuolar environment and distinguishing its role from other yeast cyclophilins.

What are the most significant open questions in CPR4 research?

The field of CPR4 research in Saccharomyces cerevisiae still faces several significant open questions that present opportunities for impactful investigation:

  • Physiological substrates and functions: While CPR4 is known to be a peptidyl-prolyl cis-trans isomerase localized to vacuoles, its specific physiological substrates and precise cellular functions remain largely uncharacterized . Identifying the proteins that require CPR4 for proper folding or function would significantly advance our understanding of its biological role.

  • Regulatory mechanisms: How CPR4 activity is regulated in response to cellular conditions remains unclear. Investigation of post-translational modifications, protein-protein interactions, and expression level changes under various conditions would provide insights into its regulation.

  • Vacuolar function specificity: Why certain cyclophilins like CPR4 and Cpr8 are specifically targeted to vacuoles while others localize to different cellular compartments is not fully understood . The functional significance of this specialized localization requires further investigation.

  • Cross-talk with other cyclophilins: The extent of functional redundancy or complementarity between CPR4 and other yeast cyclophilins, particularly Cpr8 which shares vacuolar localization, remains to be elucidated .

  • Structural determinants of function: Without high-resolution structural data for CPR4, the molecular basis for its substrate specificity and catalytic mechanism remains incompletely understood. The successful recombinant expression and purification methodologies developed for related proteins provide a foundation for addressing this gap .

  • Evolutionary significance: Understanding why yeast maintains multiple cyclophilins with distinct localizations, including CPR4 in vacuoles, could reveal important insights into the evolution of protein quality control systems and specialized cellular functions .

  • Therapeutic relevance: While cyclophilins are important drug targets in other contexts (e.g., cyclosporin A targeting cyclophilin A), the potential relevance of CPR4 or its homologs as therapeutic targets has not been extensively explored.

Addressing these questions would not only advance our understanding of CPR4 biology but also provide broader insights into protein folding, quality control, and vacuolar function in eukaryotic cells.

What future technologies might advance CPR4 research?

Emerging technologies and methodological advances promise to significantly enhance our understanding of CPR4 biology in the coming years:

  • Cryo-Electron Microscopy (cryo-EM): As cryo-EM technology continues to improve for smaller proteins, it may enable high-resolution structural determination of CPR4 alone and in complex with substrates, bypassing crystallization challenges.

  • AlphaFold and AI-based structure prediction: The application of advanced AI algorithms for protein structure prediction may provide increasingly accurate models of CPR4, its interactions, and dynamics even in the absence of experimental structures.

  • Single-molecule enzymology: Technologies that enable observation of enzyme catalysis at the single-molecule level could provide unprecedented insights into the kinetics and conformational changes associated with CPR4's peptidyl-prolyl isomerase activity.

  • Proximity labeling advances: Next-generation proximity labeling technologies with improved spatial and temporal resolution will enable more precise mapping of CPR4's interaction network within the vacuolar environment .

  • CRISPR-based genetic screens: Advanced CRISPR screening approaches can identify genetic interactions and pathways connected to CPR4 function with greater precision and scale than traditional genetic methods.

  • Real-time monitoring of protein folding: Emerging technologies for monitoring protein folding in vivo could reveal the direct impact of CPR4 on substrate protein conformations in their native cellular context.

  • Microfluidics-based directed evolution: Advanced microfluidics platforms could accelerate directed evolution of CPR4 variants with enhanced or altered functions by enabling higher-throughput screening of larger libraries .

  • Integrative structural biology approaches: Combining multiple structural methodologies (X-ray crystallography, NMR, SAXS, HDX-MS) will provide complementary insights into CPR4 structure and dynamics.

  • Single-cell proteomics: As single-cell proteomics technologies mature, they may reveal cell-to-cell variability in CPR4 function and its impact on cellular phenotypes.

  • Advanced computational simulation: Molecular dynamics simulations with improved force fields and greater time scales will enable more accurate modeling of CPR4 catalysis and interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.