Recombinant Saccharomyces cerevisiae Peroxisomal membrane protein PEX28 (PEX28)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Peroxisomal Membrane Protein PEX28 (PEX28)

Recombinant Saccharomyces cerevisiae Peroxisomal membrane protein PEX28, commonly referred to as Pex28p, plays a crucial role in peroxisome dynamics within the yeast Saccharomyces cerevisiae . Peroxisomes are essential organelles involved in various metabolic processes, including fatty acid oxidation and the synthesis of certain amino acids . Pex28p, along with other peroxins such as Pex29p, Pex30p, Pex31p, and Pex32p, is integral in controlling the size, number, and distribution of peroxisomes within the cell .

Genetic and Molecular Identification

The identification of Pex28p stemmed from sequence similarities with peroxins in other organisms. Specifically, the Yarrowia lipolytica peroxin Pex24p showed high sequence similarity to hypothetical proteins Yhr150p and Ydr479p in S. cerevisiae . These proteins, Yhr150p and Ydr479p, were subsequently identified as peroxisomal integral membrane proteins and designated as Pex28p and Pex29p, respectively, due to their roles in peroxisome dynamics . The corresponding genes for Pex28p and Pex29p are YHR150w and YDR479c .

Functional Role in Peroxisome Dynamics

Pex28p is involved in regulating peroxisome number, size, and distribution . Deletion of the PEX28 gene results in an increased number of peroxisomes that exhibit clustering and are smaller in size compared to wild-type cells . Additionally, these peroxisomes often show membrane thickening between adjacent peroxisomes within a cluster .

Systematic deletion of genes demonstrated that PEX28 functions upstream of YLR324w, YGR004w, and YBR168w in the regulation of peroxisome proliferation .

Interactions with Other Peroxins

Pex28p interacts with other peroxins, such as Pex29p, Pex30p, Pex31p, and Pex32p, to control peroxisome size and number . These interactions were confirmed through yeast two-hybrid analysis, providing evidence of physical associations between Pex28p and the S. cerevisiae homologues of YlPex23p and YlPex24p .

Relationship to Pex30-like Proteins

Pex28 is part of the Pex30-like protein family, which also includes Pex29, Pex31, and Pex32 . These proteins target and function at multiple membrane contact sites (MCSs) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
PEX28; YHR150W; Peroxisomal membrane protein PEX28; Peroxin-28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PEX28
Target Protein Sequence
MSETSSSRRSASKDAVKSYFAGKYNKVLDSILEAEAAISKSPTVAEDLSGSSSSGNSEMS HPSLTASSATSQGISKKELLQQIAGSLFSTSIERLKTAHSSEVSSTPEYSVNDSYGEQEC RECDGVFKCSAHFEGAPEYYDDETESGPALEPMTSNSEKDPFIDVFLDKLISRLVPEKLP EREHFSSKTTIEHDLDTGRVPVFSATTLGSNFKKLSKKMGSIFELQDSIVRLLTWRNPTG TVTSLILFTLICFNPMYLVILPIFRFVYGIVVPGYVRKHPLQRSIYPLKRNHGSSLLYDV CYEGKNEYSYGQQFFSKSFMDTLESRNQEIDEISELDKRTENTGELKQGMKVLINLRDMQ NMTSGTLHVIEAINSFLRKSSSFQNEECSTKRFFTGFLLIVFLKILSPFVNWSYVCSIFA WCLLIYMHPRAHPKIISFFKTGTMGKEYKNLKKREHQALNMIFDEQPETKFIEIFEIYKK ALLPNDWKFFRYSNRIFDPQDPYRRAQQFPPGVDSLADVIPPTGWSFDPNFEWKIDNDVD RWVVERGLNLPITGEFLFDPMFKRRRLIHRVIKNATPVA
Uniprot No.

Target Background

Function

Function: Involved in the regulation of peroxisome number, size, and distribution.

Database Links

KEGG: sce:YHR150W

STRING: 4932.YHR150W

Protein Families
Peroxin-2832 family, Peroxin-28 subfamily
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of PEX28 in Saccharomyces cerevisiae?

PEX28 (YHR150W, Peroxin-28) is a full-length peroxisomal membrane protein consisting of 579 amino acids in Saccharomyces cerevisiae. The protein contains multiple transmembrane domains that anchor it to the peroxisomal membrane . As part of the peroxisome biogenesis machinery, PEX28 contributes to peroxisome proliferation and membrane dynamics. The protein contains specific structural motifs that facilitate its integration into the peroxisomal membrane and interaction with other peroxins.

How conserved is PEX28 across different species?

PEX28 belongs to the broader family of 37 known PEX proteins involved in peroxisome biogenesis . Comparative genomics studies have shown varying degrees of conservation across eukaryotes. Researchers typically employ reciprocal sequence searches and protein profile methods (Hidden Markov models) to detect orthologs across species . When studying PEX28 conservation, it's important to use multiple sequence alignment tools like MAFFT followed by phylogenetic analysis using software such as IQ-TREE to establish evolutionary relationships and determine conservation patterns reliably.

What are the known domains and motifs in the PEX28 protein?

The full-length PEX28 protein (1-579aa) contains several functional domains and motifs. Based on the amino acid sequence, PEX28 contains multiple predicted transmembrane regions that facilitate its integration into the peroxisomal membrane . Protein disorder prediction using tools like IUPRED and transmembrane helix prediction using TMHMM can help identify these structural elements . Functional annotation using the Pfam database can further elucidate specific domains within the protein that contribute to its biological activity in peroxisome biogenesis.

What expression systems are optimal for producing recombinant PEX28 protein?

For recombinant PEX28 production, E. coli has been successfully utilized as an expression system for the full-length Saccharomyces cerevisiae PEX28 protein . When expressing the recombinant protein, consider using an N-terminal His-tag system which allows for efficient purification while maintaining protein functionality. The optimal expression conditions should be determined empirically, as membrane proteins can be challenging to express. Temperature, induction time, and inducer concentration should be optimized to maximize yield while maintaining proper protein folding.

What are the recommended storage and reconstitution procedures for recombinant PEX28?

Recombinant PEX28 protein should be stored as a lyophilized powder at -20°C/-80°C upon receipt . For long-term storage, it's advisable to:

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot the solution to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

For reconstitution, briefly centrifuge the vial before opening to bring contents to the bottom, then add the appropriate buffer. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .

What purification methods yield the highest purity of recombinant PEX28?

For His-tagged recombinant PEX28, immobilized metal affinity chromatography (IMAC) is the primary purification method. A typical purification procedure includes:

  • Cell lysis using methods optimized for membrane proteins (detergent solubilization)

  • Binding to Ni-NTA or similar metal affinity resin

  • Washing with increasing concentrations of imidazole to remove non-specific binding

  • Elution with high imidazole buffer

  • Further purification by size exclusion chromatography if needed

This approach can yield protein purity greater than 90% as determined by SDS-PAGE . For membrane proteins like PEX28, the choice of detergent is critical during purification to maintain native conformation and activity.

How can I determine PEX28's interaction partners in the peroxisomal membrane?

To identify PEX28 interaction partners, several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against PEX28 or its tag to pull down the protein complex, followed by mass spectrometry analysis

  • Yeast two-hybrid (Y2H) screening: Particularly useful for identifying direct protein interactions

  • Proximity-dependent biotin identification (BioID): By fusing PEX28 to a biotin ligase to biotinylate proximal proteins

  • Chemical cross-linking coupled with mass spectrometry: To capture transient interactions

Genetic approaches like E-MAP (Epistatic Miniarray Profile) analysis can also reveal functional interactions by identifying genes whose deletion shows synthetic effects with PEX28 deletion . When analyzing the data, it's important to validate key interactions through reciprocal Co-IP or through functional assays.

What is known about PEX28's role in peroxisome biogenesis and homeostasis?

PEX28 is part of the broader peroxisome biogenesis machinery, contributing to peroxisome proliferation and membrane dynamics. Research approaches to study its specific role include:

  • Genetic deletion studies: Analyzing phenotypes of PEX28 deletion mutants

  • Localization studies: Using fluorescent protein fusions to track PEX28 distribution

  • Functional complementation assays: Reintroducing PEX28 into deletion strains

When investigating peroxisome homeostasis, researchers should consider the redundant functions between PEX proteins. For example, the study of FLC proteins (suspected FAD or calcium transporters of the ER) showed redundancy between FLC1, FLC2, and FLC3 in providing an essential function . Similar functional redundancy might exist between PEX28 and other peroxins, requiring careful experimental design to delineate specific contributions.

How does PEX28 contribute to lipid metabolism in yeast cells?

The potential role of PEX28 in lipid metabolism can be investigated through:

  • Lipidomic analysis: Comparing lipid profiles between wild-type and PEX28 mutant strains

  • Metabolic labeling: Tracking the incorporation of labeled fatty acid precursors

  • Genetic interaction studies: Analyzing double mutants with genes involved in lipid metabolism

Research has shown that peroxisomal proteins interact with various lipid metabolic pathways. For instance, the study cited in the search results demonstrated interactions between peroxisomal proteins and enzymes like Cst26, which transfers stearic acid (C18:0) to the sn-1 position of lyso-PI . Investigating similar interactions for PEX28 could reveal its specific roles in lipid metabolism.

What are the most common pitfalls when working with recombinant PEX28 and how can they be avoided?

Common challenges when working with recombinant PEX28 include:

  • Low expression levels: As a membrane protein, PEX28 may express poorly in heterologous systems. Optimize codon usage, consider using fusion partners that enhance solubility, and test different expression strains.

  • Protein aggregation: Membrane proteins often aggregate during expression or purification. Use mild detergents suitable for membrane proteins and avoid harsh solubilization conditions.

  • Loss of activity: Maintain the cold chain during purification and add stabilizers like glycerol to purification buffers.

  • Reconstitution difficulties: When reconstituting the lyophilized protein, follow the recommended procedure of brief centrifugation before opening the vial and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage instability: Store as recommended with 5-50% glycerol in aliquots to prevent freeze-thaw cycles .

How can I design robust assays to measure PEX28 functionality?

Designing functional assays for PEX28 requires understanding its role in peroxisome biogenesis:

  • Peroxisome proliferation assays: Measure peroxisome number and morphology in wild-type versus PEX28 mutant cells using fluorescent markers for peroxisomes.

  • Complementation assays: Test if the recombinant PEX28 can rescue phenotypes in PEX28-deficient yeast strains.

  • Interaction assays: Measure binding to known partners using techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST).

  • Membrane integration assays: Assess the protein's ability to properly integrate into membranes using proteoliposome reconstitution followed by protease protection assays.

When designing these assays, include appropriate positive and negative controls and ensure that the recombinant protein preparation maintains native-like properties by verifying proper folding through circular dichroism or limited proteolysis.

How should I interpret genetic interaction data involving PEX28?

When interpreting genetic interaction data for PEX28:

  • Consider regional effects: Genetic studies have shown that adjacent deletions in chromosomal regions can show strong negative genetic interactions with a single gene on another chromosome, suggesting the presence of undeclared suppressor mutations . For example, in E-MAP studies, researchers observed that the chromosomal region containing CST26 showed negative S scores with CHS1 deletion .

  • Validate key interactions: Confirm genetic interactions using alternative methods such as tetrad analysis or plasmid complementation.

  • Analyze functional categories: Group interacting genes by function to identify biological processes connected to PEX28.

  • Account for technical artifacts: Be aware that some apparent genetic interactions might result from technical issues like suppressor mutations rather than true biological connections .

What bioinformatic approaches are most effective for identifying PEX28 orthologs across species?

For effective ortholog detection of PEX28 and other PEX proteins, researchers typically employ a dual approach:

  • Reciprocal searches of single protein sequences: Using tools like phmmer from the HMMER package to identify reciprocal best hits across proteomes .

  • Profile-based searches: Using tools like jackhmmer followed by hmmsearch to detect more divergent orthologs based on Hidden Markov Models .

For transmembrane proteins like PEX28, it's recommended to use relaxed e-value thresholds (around 1e-2) with fewer iterations . After identifying potential orthologs, perform multiple sequence alignment using MAFFT (einsi-mode) followed by manual inspection to filter out false positives . For suspected missing orthologs, build HMM profiles from existing alignments and search the target proteome.

Remember that failure to identify an ortholog doesn't necessarily mean absence - it could result from incomplete genome information or sequence divergence .

How can I integrate PEX28 studies with broader peroxisome biogenesis research?

To integrate PEX28 studies within the broader context of peroxisome biogenesis:

  • Systematic interaction mapping: Position PEX28 within the network of all 37 known PEX proteins through comprehensive interaction studies .

  • Evolutionary analysis: Compare PEX28 conservation patterns with other peroxins to identify co-evolutionary relationships.

  • Functional grouping: Determine if PEX28 belongs to a specific functional module within the peroxisome biogenesis machinery.

  • Multi-omics integration: Combine proteomics, lipidomics, and transcriptomics data to understand PEX28's contribution to peroxisomal functions.

Understanding the relationship between PEX28 and other peroxins requires considering both physical and genetic interactions. For example, research has shown that peroxisomal proteins can have redundant functions, as demonstrated with FLC proteins .

What are the current limitations in our understanding of PEX28 and what key experiments could address these gaps?

Current limitations in PEX28 research include:

  • Incomplete functional characterization: While PEX28 is known to be involved in peroxisome biogenesis, its precise molecular function remains incompletely understood.

  • Limited structural information: The three-dimensional structure of PEX28 has not been fully determined.

  • Unclear regulation mechanisms: How PEX28 activity is regulated in response to cellular needs for peroxisome biogenesis remains unclear.

Key experiments to address these gaps include:

  • Structural studies: Cryo-EM or X-ray crystallography of purified PEX28 to determine its structure.

  • Systematic mutagenesis: Identify critical residues for PEX28 function through comprehensive alanine scanning.

  • Temporal regulation studies: Investigate how PEX28 expression and localization change under different metabolic conditions.

  • Interaction network mapping: Comprehensive identification of all PEX28 interaction partners under various conditions.

  • Comparative studies across species: Analyze functional conservation and divergence of PEX28 orthologs in different organisms using the methodologies described for ortholog detection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.