Recombinant Saccharomyces cerevisiae Peroxisomal membrane protein PEX34 (PEX34)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Peroxisomal Membrane Protein PEX34 (PEX34)

Recombinant Saccharomyces cerevisiae Peroxisomal membrane protein PEX34 (PEX34) is a novel peroxisomal integral membrane protein identified in the yeast Saccharomyces cerevisiae. It plays a crucial role in controlling peroxisome abundance and division, interacting with other peroxins to regulate peroxisome populations under various conditions . PEX34 is integral to maintaining the balance of peroxisomes within cells, ensuring proper cellular function and response to environmental changes.

Structure and Function of PEX34

PEX34 contains three transmembrane spanning regions, as predicted by topology prediction programs such as SOSUI, HMMTOP, and TMpred . This structural feature is consistent with its role as an integral membrane protein of peroxisomes. Functionally, PEX34 acts both independently and in concert with the Pex11 family proteins (Pex11p, Pex25p, and Pex27p) to control peroxisome division and proliferation .

Interactions and Partnerships

PEX34 physically interacts with itself and members of the Pex11 family, facilitating its role in peroxisome division . Additionally, it interacts with Pex19p and other peroxisomal membrane proteins in a PEX19-dependent manner . PEX34 also functions as a contact site tether between peroxisomes and mitochondria, enhancing the formation of peroxisome-mitochondria contact sites upon overexpression .

Role in Peroxisome-Mitochondria Contact Sites

Overexpression of PEX34 increases peroxisome-mitochondria contacts, facilitating the transport of metabolites such as citrate between these organelles . This interaction is crucial for metabolic processes, particularly in conditions where mitochondrial function is impaired .

Research Findings and Implications

AspectDescriptionImplications
Peroxisome DivisionPEX34 promotes peroxisome division by interacting with Pex11 family proteins .Essential for maintaining optimal peroxisome numbers.
Peroxisome-Mitochondria ContactsEnhances contact site formation, facilitating metabolite transport .Important for cellular metabolism and stress response.
Protein InteractionsInteracts with Pex19p and other PMPs in a PEX19-dependent manner .Highlights the complexity of peroxisomal biogenesis and regulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX34; YCL056C; YCL433; YCL56C; Peroxisomal membrane protein PEX34; Peroxin-34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PEX34
Target Protein Sequence
MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM VLIYPGTRLFKRLSNIITLCRIIV
Uniprot No.

Target Background

Function
PEX34, in conjunction with the peroxisome division factors PEX11, PEX25, and PEX27, regulates peroxisome morphology and abundance during peroxisome proliferation. It maintains mature peroxisomes in actively dividing cells.
Gene References Into Functions
  1. The discovery of Pex34p as a protein involved in the complex regulation of peroxisome populations highlights the critical cellular need for precise control of peroxisome numbers. [pex34p] PMID: 21441307
Database Links

KEGG: sce:YCL056C

STRING: 4932.YCL056C

Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is PEX34 and what is its cellular localization?

PEX34 (originally designated as YCL056c) is a novel peroxisomal integral membrane protein in Saccharomyces cerevisiae that plays a crucial role in controlling peroxisome abundance. Localization studies using GFP-tagged Pex34p have confirmed its peroxisomal membrane localization through a punctate fluorescence pattern characteristic of peroxisomes. Biochemical fractionation experiments demonstrate that Pex34p cofractionates with known peroxisomal membrane proteins like Pex3p in the pellet fraction after sodium carbonate extraction, confirming its status as an integral membrane protein rather than a peripheral membrane protein .

What is the predicted structure of PEX34?

Pex34p is predicted to contain three transmembrane spanning regions according to multiple topology prediction programs including SOSUI, HMMTOP, and TMpred . This integral membrane protein structure is consistent with its resistance to extraction by sodium carbonate treatment, which typically releases peripheral membrane proteins while retaining integral membrane proteins in the membrane fraction .

How was PEX34 initially identified?

The PEX34 gene was initially identified through high-throughput protein interaction studies that revealed potential interactions between the product of S. cerevisiae ORF YCL056c and several peroxins involved in peroxisome biogenesis. Additionally, global protein localization analysis in S. cerevisiae using fluorescence microscopy showed GFP-tagged Ycl056c protein displaying a punctate fluorescence pattern characteristic of peroxisomes . These findings prompted researchers to investigate whether this protein was indeed peroxisomal and involved in peroxisome biogenesis, leading to its designation as a peroxin, Pex34p.

What proteins does PEX34 interact with in the peroxisomal system?

Yeast two-hybrid analysis has demonstrated that Pex34p physically interacts with multiple proteins involved in peroxisome biogenesis and division:

Interacting PartnerInteraction ConfirmedFunctional Relationship
Pex11pYesMember of Pex11 family; peroxisome division
Pex25pYesMember of Pex11 family; peroxisome division
Pex27pYesMember of Pex11 family; peroxisome division
Fis1pYesInvolved in both mitochondrial fission and peroxisome division
Pex34p (self)YesHomo-oligomerization
Vps1pNoDynamin-like protein involved in peroxisome fission
Pex19pYesPMP chaperone and import receptor
These interactions have been validated using β-galactosidase filter detection assays and appear to be specific, as the AD and BD fusion constructs showed no self-activation .

How does PEX34 regulate peroxisome abundance?

Pex34p functions as a positive regulator of peroxisome division. This is evidenced by:

  • Deletion phenotype: Cells lacking PEX34 (pex34Δ) exhibit fewer peroxisomes than wild-type cells under both peroxisome proliferation conditions (growth in oleic acid medium) and constitutive peroxisome division conditions (growth in glucose medium) .

  • Overexpression effect: Overproduction of Pex34p leads to increased numbers of peroxisomes in wild-type and pex34Δ cells, demonstrating its role as a positive effector of peroxisome division .

  • Dependency relationship: Pex34p requires members of the Pex11 protein family to promote peroxisome division, as overexpression of PEX34 failed to increase peroxisome numbers in pex11Δ, pex25Δ, or pex27Δ cells .
    These findings position Pex34p as a key component in the complex regulatory network controlling peroxisome populations in yeast cells.

What phenotypes are observed in pex34Δ cells during peroxisome proliferation?

Deletion of the PEX34 gene results in several observable phenotypes:

  • Reduced peroxisome numbers: pex34Δ cells contain fewer peroxisomes than wild-type cells under both peroxisome proliferation conditions (oleic acid medium) and constitutive division conditions (glucose medium) .

  • Enlarged peroxisomes: Electron microscopy reveals that pex34Δ cells grown in oleic acid-containing medium have larger peroxisomes compared to wild-type cells .

  • Time-course analysis: Quantification of Pot1p-GFP labeled peroxisomes shows consistently fewer peroxisomes in pex34Δ cells compared to wild-type cells throughout an 8-hour time course of oleic acid induction .
    These phenotypes collectively demonstrate that Pex34p plays an important role in maintaining proper peroxisome abundance and potentially in controlling peroxisome size.

How can researchers visualize and quantify PEX34's effects on peroxisome populations?

Researchers can employ several methodological approaches to visualize and quantify PEX34's effects:

  • Fluorescence microscopy: Using peroxisome-targeted fluorescent proteins like Pot1p-GFP or Mdh2p-GFP to visualize peroxisomes in living cells .

  • Confocal microscopy: For high-resolution imaging and accurate quantification of peroxisome numbers per cell .

  • Time-course imaging: Monitoring changes in peroxisome populations over time following induction of peroxisome proliferation .

  • Electron microscopy: For detailed analysis of peroxisome morphology, size, and ultrastructure .

  • Conditional expression systems: Using galactose-inducible promoters (like GAL1) to control expression of PEX34 and other peroxins to study their effects on peroxisome dynamics .

What genetic approaches are most informative for studying PEX34 function?

The following genetic approaches have proven particularly valuable for elucidating PEX34 function:

  • Single and double gene deletions: Comparing phenotypes of pex34Δ single mutants with pex34Δpex11Δ, pex34Δpex25Δ, and pex34Δpex27Δ double mutants to understand genetic interactions .

  • Overexpression studies: Using galactose-inducible promoters to overexpress PEX34 in various genetic backgrounds to assess effects on peroxisome abundance .

  • Epistasis analysis: Determining the hierarchy of function among peroxins by overexpressing one peroxin in the absence of another (e.g., overexpressing PEX34 in cells lacking Pex11 family members) .

  • Protein-protein interaction assays: Employing yeast two-hybrid analysis to identify physical interaction partners of Pex34p .

  • Conditional depletion systems: Using regulatable promoters to control PEX19 expression and study de novo peroxisome formation in various mutant backgrounds .

How is PEX34 involved in de novo peroxisome biogenesis?

Recent research has identified Pex34p as a crucial component of the peroxisomal de novo biogenesis machinery in yeast:

  • A screen of approximately 6,000 yeast mutants depleted of peroxisomes through conditional inhibition of PEX19 expression identified Pex34p, along with the well-known component Pex25p, as critical determinants for de novo biogenesis .

  • Pex34p interacts with Pex19p and with different Peroxisomal Membrane Proteins (PMPs) in a PEX19-dependent manner .

  • Depletion of Pex34p results in reduced numbers of import-competent peroxisomes, suggesting its role in the early stages of peroxisome formation .
    This research positions Pex34p at the intersection of both division-mediated and de novo pathways of peroxisome biogenesis, highlighting its versatile role in peroxisome dynamics.

What is the relationship between PEX34 and cellular metabolism in yeast?

PEX34 has been implicated in metabolic adaptation through unexpected pathways:

  • PEX34 was identified as a high-copy suppressor capable of bypassing impaired acetate utilization in agc1Δ yeast (cells lacking the mitochondrial aspartate-glutamate carrier) .

  • Surprisingly, this improved growth on acetate is not mediated through peroxisome proliferation. Instead, stress to the endoplasmic reticulum and mitochondria from PEX34 overexpression appears to contribute to enhanced acetate utilization .

  • The citrate/2-oxoglutarate carrier Yhm2p is required for PEX34-stimulated growth of agc1Δ yeast on acetate medium, suggesting that the suppressor effect is mediated through increased activity of a redox shuttle involving mitochondrial citrate export .

  • Metabolomic analysis revealed redirection of acetyl-CoA from synthetic reactions for amino acids in PEX34 overexpression conditions .
    These findings suggest that Pex34p may have functions beyond peroxisome division that impact cellular metabolic pathways.

How conserved is PEX34 across different species?

PEX34 appears to have limited evolutionary conservation compared to many other peroxins:

  • The PEX34 gene (YCL056c) of S. cerevisiae is conserved in several members of the Saccharomycetaceae family .

  • Unlike many other peroxins that have clear homologs in mammalian cells, PEX34 appears to be more restricted to fungi, particularly budding yeasts.

  • This relative lack of wide conservation suggests that Pex34p may represent a specialized adaptation for peroxisome regulation in yeast rather than a universally required component of the peroxisome biogenesis machinery.

What experimental tools are available for studying PEX34 protein dynamics?

Researchers studying PEX34 can employ various molecular tools:

ToolApplicationKey Features
GFP-Pex34p fusionLocalization studiesEnables visualization of Pex34p in living cells
GAL1 promoter constructsControlled overexpressionAllows titration of Pex34p levels through galactose induction
Yeast two-hybrid vectorsProtein interaction studiesEnables mapping of Pex34p interactome
Pex34p antibodiesProtein detectionWestern blotting and immunofluorescence applications
PEX34 deletion strainsLoss-of-function studiesAnalysis of phenotypes in absence of Pex34p
Epitope-tagged Pex34pBiochemical analysisPurification and interaction studies
These tools have been instrumental in characterizing Pex34p's function, localization, and interaction partners in the context of peroxisome biogenesis.

What are the key unresolved questions about PEX34 function?

Several important aspects of PEX34 biology remain to be fully elucidated:

  • The precise molecular mechanism by which Pex34p promotes peroxisome division.

  • The structural basis for Pex34p's interactions with the Pex11 family proteins.

  • The potential role of post-translational modifications in regulating Pex34p activity.

  • The mechanistic details of how Pex34p contributes to de novo peroxisome biogenesis.

  • Whether Pex34p has additional functions beyond peroxisome division and biogenesis.
    Addressing these questions will provide deeper insights into the complex regulatory network controlling peroxisome dynamics in yeast.

What methodological advances would enhance PEX34 research?

Future research on PEX34 would benefit from several methodological advances:

  • Cryo-electron microscopy to determine the structure of Pex34p and its complexes.

  • Super-resolution microscopy to visualize Pex34p dynamics during peroxisome division.

  • Proximity-dependent labeling techniques to map the Pex34p interactome in intact cells.

  • CRISPR-based genome editing for more precise manipulation of PEX34.

  • Systems-level approaches to integrate PEX34 function into broader cellular networks. These advances would help resolve current knowledge gaps and place PEX34 function in a more comprehensive cellular context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.