Recombinant Saccharomyces cerevisiae Peroxisome assembly protein 22 (PEX22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX22; YAL055W; Peroxisome assembly protein 22; Peroxin-22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PEX22
Target Protein Sequence
MPPPSRSRINKTRTLGIVGTAIAVLVTSYYIYQKVTSAKEDNGARPPEGDSVKENKKARK SKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDS MDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCN
Uniprot No.

Target Background

Function
Involved in peroxisome biogenesis.
Gene References Into Functions
  1. Pex22p dysfunction, resulting from mutation, increased malate productivity and dimethyl succinate sensitivity in yeast cells. [PMID: 28919252](https://www.ncbi.nlm.nih.gov/pubmed/28919252)
  2. The cytosolic domain of Pex22p stimulates Pex4p-dependent ubiquitination of the PTS1 receptor (Pex5). [PMID: 25162638](https://www.ncbi.nlm.nih.gov/pubmed/25162638)
  3. The Pex4p:Pex22p complex, not Pex4p alone, functions as the E2 enzyme for Pex5p ubiquitination, representing a novel E2 enzyme regulation mechanism. [PMID: 22085930](https://www.ncbi.nlm.nih.gov/pubmed/22085930)
  4. The N-domain of Pex22p can functionally replace the Pex3p N-domain in peroxisome targeting and formation. [PMID: 19017643](https://www.ncbi.nlm.nih.gov/pubmed/19017643)
Database Links

KEGG: sce:YAL055W

STRING: 4932.YAL055W

Protein Families
Peroxin-22 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What experimental strategies are recommended for expressing and purifying recombinant PEX22 in E. coli?

Recombinant PEX22 expression in E. coli requires careful optimization due to its peroxisomal membrane-targeting domains and potential cytotoxicity. Source confirms successful expression of full-length PEX22 (1–180 aa) with an N-terminal His tag in E. coli, yielding >90% purity via affinity chromatography. Key considerations include:

  • Codon Optimization: Adjust rare codons in the S. cerevisiae PEX22 sequence for E. coli compatibility.

  • Solubility: Use low-temperature induction (18–20°C) and solubility-enhancing tags (e.g., MBP or GST) for membrane-proximal regions.

  • Purification: Employ stepwise imidazole elution (10–250 mM) to separate full-length protein from degradation products. Post-purification, validate structural integrity via circular dichroism (CD) spectroscopy or limited proteolysis assays.

How does PEX22 interact with PEX4, and what methodologies resolve their binding dynamics?

PEX22 anchors the ubiquitin-conjugating enzyme PEX4 to the peroxisomal membrane via a conserved C-terminal domain. Structural studies in Arabidopsis ( ) and Hansenula polymorpha ( ) reveal:

  • Binding Interface: The PEX4-PEX22 complex forms salt bridges between PEX4’s α-helix 3 (e.g., Arg94 in Arabidopsis) and PEX22’s acidic residues (e.g., Glu141).

  • Methodologies:

    • Yeast Two-Hybrid: Used in Fusarium graminearum to confirm direct PEX4-PEX22 interaction ( ).

    • Co-Immunoprecipitation (Co-IP): Validate interactions in native lysates using anti-PEX4/PEX22 antibodies ( ).

    • X-Ray Crystallography: Resolve binding at 2.0–2.85 Å resolution (Table 3, ).

What functional assays confirm PEX22’s role in peroxisome biogenesis?

PEX22 is critical for peroxisomal matrix protein import and receptor recycling. Key assays include:

  • Peroxisome Localization: Fluorescence microscopy of GFP-tagged PEX5 in Δpex22 mutants shows cytosolic mislocalization ( ).

  • Ubiquitination Assays: In vitro ubiquitination of PEX5 by the PEX4-PEX22 complex, monitored via Western blot using anti-ubiquitin antibodies ( ).

  • Metabolic Phenotyping: Δpex22 strains fail to grow on oleate/methanol media ( ) and overproduce malate due to mislocalized Mdh3p ( ).

How do structural differences in PEX22 orthologs impact functional studies?

Despite low sequence conservation, PEX22 orthologs share a Rossmann fold-like structure and transmembrane domain (Table 1):

OrganismKey Structural FeaturesFunctional ImpactSource
S. cerevisiaeSingle TM domain (residues 15–35), C-terminal PEX4-binding interfacePEX4 tethering, PEX5 recycling ,
F. graminearum14.34% identity to C. orbiculare FAM1; conserved PEX4-binding motifPathogenicity, Woronin body formation
Arabidopsis thalianaP123L mutation near PEX4 active site reduces ubiquitination efficiencyPeroxisomal dysfunction in pex4-1 mutants

For cross-species studies, use directed evolution or chimeric protein constructs to test functional complementation ( ).

What advanced techniques address contradictions in PEX22’s role across species?

Discrepancies in PEX22’s involvement in processes like Woronin body formation ( ) versus malate metabolism ( ) require:

  • CRISPR-Cas9 Knock-In: Replace endogenous PEX22 with orthologs (e.g., F. graminearum PEX22-like) in S. cerevisiae to assess functional conservation.

  • Quantitative Proteomics: Compare peroxisomal matrix proteomes of Δpex22 strains using SILAC or TMT labeling.

  • Molecular Dynamics (MD) Simulations: Model PEX4-PEX22 binding dynamics under varying pH (e.g., peroxisomal matrix pH ~6.8) to predict interaction stability ( ).

How do mutations in PEX22 affect peroxisomal ubiquitination pathways?

The pex4-1 (P123L) mutation in Arabidopsis reduces ubiquitination activity by altering the PEX4 active site geometry ( ). Similarly, a nonsense mutation in S. cerevisiae PEX22 (F-701H strain) disrupts peroxisomal Mdh3p import, elevating cytosolic malate ( ). To dissect mutational effects:

  • Deep Mutational Scanning: Screen PEX22 mutants for PEX4 binding using yeast surface display.

  • Enzyme Kinetics: Compare kcat and Km of wild-type vs. mutant PEX4-PEX22 complexes using fluorescent ubiquitin derivatives (e.g., Ub-AMC).

What computational tools predict PEX22’s membrane topology?

PEX22’s single transmembrane (TM) domain (residues 15–35 in S. cerevisiae) can be modeled using:

  • Phobius: Predicts TM helices with 98% accuracy for peroxisomal membrane proteins ( ).

  • AlphaFold2: Generates full-length structures (pLDDT >85 for cytosolic domains) ( ).

  • MD Simulations in Lipid Bilayers: Assess membrane embedding using CHARMM36m force fields ( ).

How is PEX22 implicated in fungal pathogenicity, and what assays validate this?

In F. graminearum, Δpex22-like strains show:

  • Reduced Virulence: 82.3% decrease in wheat head infection ( ).

  • Cell Wall Defects: Sensitivity to Congo Red (40% growth inhibition) and lysozyme ( ).

  • ROS Accumulation: 60% higher intracellular ROS levels vs. wild-type (NBT staining) ( ).
    To validate, perform host infection assays under controlled ROS conditions (e.g., 20 mM H2O2) and quantify fungal biomass via qPCR.

What crystallization conditions yield high-resolution PEX4-PEX22 structures?

From H. polymorpha ( ):

ParameterPEX4 AlonePEX4-PEX22 Complex
Buffer20 mM Tris pH 7.5, 150 mM NaCl20 mM HEPES pH 7.0, 200 mM NaCl
Precipitant18% PEG 335012% PEG 8000
Crystal MorphologyRod-shaped (P4<sub>1</sub>2<sub>1</sub>2)Plate-like (P1)
Resolution (Å)2.002.85

Optimize seeding techniques and use microgravity (e.g., ISS experiments) to improve crystal size.

How does PEX22 dysfunction alter cellular redox states?

Δpex22 strains accumulate ROS due to impaired peroxisomal β-oxidation and catalase mislocalization. Monitor using:

  • Fluorescent Probes: CM-H2DCFDA for general ROS; MitoSOX for mitochondrial superoxide.

  • Metabolomics: LC-MS quantification of NADPH/NADP+ ratios (expect 2.5-fold decrease in Δpex22).

  • Genetic Suppressors: Overexpress CAT1 or SOD1 to rescue oxidative stress phenotypes ( ).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.