Recombinant Saccharomyces cerevisiae pH-response regulator protein palH/RIM21 (RIM21)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant RIM21 (UniProt ID: P48565) corresponds to the full-length, 533-amino acid protein fused with an N-terminal His-tag . Key specifications include:

PropertyDetail
Expression SystemE. coli
TagHis-tag
FormLyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0)
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in deionized water with 5–50% glycerol

Biological Role in pH Sensing

RIM21 is the primary sensor in the Rim101 pathway, which regulates fungal adaptation to alkaline environments and lipid asymmetry . Key mechanisms include:

  • Complex Formation: Interacts with Dfg16 and Rim9 to stabilize plasma membrane localization .

  • Activation Triggers:

    • External alkalization (pH >7.0).

    • Plasma membrane depolarization (e.g., via protonophores).

    • Loss of phosphatidylserine asymmetry .

  • Downstream Signaling: Recruits Rim8, ESCRT complexes, and Rim13 protease to activate transcription factor Rim101, which represses alkaline-sensitive genes .

4.1. Sensor Mechanism

  • Rim21C dissociates from the plasma membrane upon pH or lipid asymmetry changes, initiating signal transduction .

  • Transient degradation of RIM21 (but not Dfg16/Rim9) abolishes Rim101 pathway activation, confirming its role as the central sensor .

4.3. Pathogenic Relevance

The Rim101 pathway is critical for virulence in fungal pathogens (e.g., Candida albicans), making RIM21 a potential antifungal drug target .

Interaction Network

RIM21 interacts with multiple proteins in pH sensing and signaling:

ProteinRoleInteraction Score
Rim9Stabilizes RIM21 membrane localization0.995
Dfg16Maintains RIM21 cellular levels0.985
Rim101Transcription factor activated by RIM210.972
Rim8Arrestin-like adaptor for ESCRT recruitment0.989

Applications of Recombinant RIM21

  • Mechanistic Studies: Elucidating pH/lipid asymmetry sensing in fungi .

  • Drug Development: Screening inhibitors targeting RIM21 for antifungals .

  • Protein-Protein Interaction Assays: Validating interactions with Rim9, Dfg16, and ESCRT components .

Challenges and Future Directions

  • Structural Resolution: The transmembrane topology of RIM21 remains uncharacterized.

  • In Vivo Dynamics: Real-time tracking of RIM21 conformational changes during pH sensing.

  • Therapeutic Exploitation: Designing small molecules that disrupt RIM21-Rim9/Dfg16 interactions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
RIM21; PAL2; YNL294C; N0466; pH-response regulator protein palH/RIM21; Regulator of IME2 protein 21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-533
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RIM21
Target Protein Sequence
MNLWRHSPEELAAYNSCHPMKLGSGVLIQLPLYDNSAVYAEDITFRSFCCERVPVYVSTV LRNSSPYRYLDEVINDWQKFIQVSDYVGGSAEYAIYAVILSITSNFVITVFLTVICCINI SGRAYKRILQLLRIASLLASLNLTIFITKVLRRLEKEHNVYGVVRAHSIMHIFSDDMTFV VLDFLATLMFQFCQVGIVIRLFQRAQEKRIIFFIGVILTITANILWVIPPFANHTTKHRN DWQILRPFVYLFRIAIATSYASIVIYHIWQKKKLWFKFNQMGLLTLLTILVVLLLPGFFL ADVSNLWISELGEVFNTTCYVTSTVITWEWLDRLNVLERKEEAQSILGRPIFEEEQQDYR FAKYALRVQNALTRRESQDASTDRHDTSSNSEVCDLQTISRYDPEDQISVGRSIDRMHFN DRGTYKDVALKKLGYARDKILYFTDQIVQKSVGHNNSSSSKNEKTKQRKAMVRKRLGLDK PGIYIYSTKDVVFNSDEDDDENAEDEDDDEYEVGSEGNNNSSATFTSDHIGHI
Uniprot No.

Target Background

Function
Essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH. Required for growth at alkaline pH.
Gene References Into Functions
  1. The C-terminal cytosolic domain of Rim21 was associated with the plasma membrane under normal conditions but dissociated upon alterations in lipid asymmetry. PMID: 26527678
  2. Plasma membrane depolarization appears to be one of the key signals for the pH sensor molecule Rim21 PMID: 23019326
Database Links

KEGG: sce:YNL294C

STRING: 4932.YNL294C

Protein Families
PalH/RIM21 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rim21 and what is its primary function in Saccharomyces cerevisiae?

Rim21 is an integral membrane protein in Saccharomyces cerevisiae that functions as the primary sensor for ambient pH changes and plasma membrane lipid asymmetry alterations. It is a seven-transmembrane domain protein that exposes its N-terminus to the extracellular space and its C-terminus to the cytosol . As the central component of the Rim101 pathway, Rim21 plays an essential role in mediating yeast adaptation to alkaline environments by initiating signaling cascades that ultimately lead to transcriptional responses .

Research has demonstrated that Rim21 is not merely a passive component but rather the actual sensor molecule in the pH-sensing machinery, as transient degradation of Rim21 completely suppresses the Rim101 pathway activation, while degradation of other components like Dfg16 and Rim9 does not abolish the response .

How does Rim21 interact with other proteins in the Rim101 signaling pathway?

Rim21 forms a complex with two other integral membrane proteins, Dfg16 and Rim9, at the plasma membrane. These proteins localize in a patchy and mutually dependent manner . Upon detection of environmental signals:

  • Rim21 transduces the signal to downstream components including:

    • The arrestin-related protein Rim8

    • ESCRT proteins

    • The Bro1 domain-containing protein Rim20

    • The calpain-like protease Rim13

  • This signaling cascade ultimately leads to the proteolytic activation of the transcription factor Rim101, which regulates gene expression changes necessary for alkaline adaptation .

The relationship between these proteins is highly interdependent. The cellular levels of Rim21, Dfg16, and Rim9 are mutually dependent, with Rim21 levels significantly decreased in dfg16Δ and rim9Δ mutant cells. This suggests that Dfg16 and Rim9 maintain proper Rim21 levels and assist in its plasma membrane localization, while Rim21 itself serves as the actual pH sensor .

How does the C-terminal cytosolic region of Rim21 sense alterations in plasma membrane properties?

The C-terminal cytosolic domain of Rim21 (Rim21C) contains the sensory apparatus that detects both external alkalization and changes in plasma membrane lipid asymmetry. Research using GFP-fusion proteins has revealed that:

  • Under normal conditions, Rim21C associates with the plasma membrane

  • Upon external alkalization or alterations in lipid asymmetry, Rim21C dissociates from the plasma membrane

This dynamic association-dissociation behavior forms the basis of the "antenna hypothesis," which proposes that Rim21C serves as a molecular antenna that moves to or from the plasma membrane in response to environmental changes .

The Rim21C domain contains multiple clusters of charged residues that are critical for its function:

RegionCompositionFunction
EEE motifThree consecutive glutamate residuesEssential for Rim21 function and dissociation from plasma membrane during signal detection
Positively charged residuesClusters of basic amino acids adjacent to EEE motifRequired for Rim21C association with the plasma membrane under normal conditions

Mutations in the EEE motif abolish both Rim21 function and the ability of Rim21C to dissociate from the membrane in response to stimuli, highlighting its crucial role in the sensing mechanism .

What cellular signals activate the Rim101 pathway through Rim21?

Research has identified multiple cellular signals that can activate the Rim101 pathway through Rim21:

  • External alkalization: The classical activator of the pathway, which causes plasma membrane depolarization .

  • Altered plasma membrane lipid asymmetry: Changes in the distribution of phospholipids between the inner and outer leaflets of the plasma membrane, particularly the depletion of phosphatidylserine in the inner leaflet .

  • Plasma membrane depolarization: Even without external alkalization, treatments that cause plasma membrane depolarization (such as protonophore addition) can activate the Rim101 pathway in a Rim21-dependent manner .

These findings suggest that plasma membrane depolarization serves as a key signal for Rim21 activation, potentially by altering the electrostatic interactions between Rim21C and the membrane surface .

What techniques are most effective for studying Rim21 localization and dynamics?

Several complementary techniques have proven valuable for investigating Rim21 localization and dynamics:

  • Fluorescent protein tagging: Fusion of GFP or other fluorescent proteins to Rim21 or its domains allows visualization of its subcellular localization under different conditions .

  • Live cell imaging: Enables real-time observation of pH changes and protein dynamics in single cells using fluorescent pH sensors .

  • Transient protein degradation systems: Allow selective and rapid degradation of specific proteins to determine their functional importance in the pathway .

  • Coimmunoprecipitation: Identifies physical interactions between Rim21 and other components of the pH sensing machinery .

  • Mutational analysis: Systematic mutation of charged residues in Rim21C helps identify functional motifs essential for pH sensing .

When designing experiments to study Rim21, researchers should consider combining these approaches to gain comprehensive insights into both localization and function. For example, combining fluorescent imaging with mutational analysis can reveal how specific protein domains contribute to subcellular targeting and signal transduction.

How can researchers differentiate between Rim21's roles in pH sensing versus lipid asymmetry sensing?

Distinguishing between Rim21's dual sensing roles requires carefully designed experiments:

  • Selective perturbation approaches:

    • Use protonophores (like FCCP) to depolarize the plasma membrane without changing external pH

    • Employ phospholipid flippase mutants or phospholipid-binding compounds to alter lipid asymmetry without affecting pH

    • Compare Rim101 pathway activation under these different conditions

  • Domain-specific mutations:

    • Create targeted mutations in different regions of Rim21C

    • Determine which mutations specifically affect pH sensing versus lipid asymmetry sensing

    • This approach can identify domain-specific functions

  • Real-time correlation analysis:

    • Simultaneously monitor pH changes, membrane potential, lipid distribution, and Rim21 localization

    • Analyze temporal relationships between these parameters to determine causality

    • Live cell imaging with multiple fluorescent sensors is ideal for this approach

When interpreting results, researchers should be aware that these sensing mechanisms may be interconnected, as both external alkalization and lipid asymmetry alterations can cause membrane depolarization, which appears to be a common signal detected by Rim21 .

What is the relationship between Rim21-mediated pH sensing and glycolytic oscillations in S. cerevisiae?

Recent research has revealed intriguing connections between pH regulation and metabolic oscillations in yeast:

  • Addition of glucose to starved S. cerevisiae cells initiates collective NADH dynamics termed glycolytic oscillations, which are accompanied by cytoplasmic pH oscillations .

  • These oscillations can be observed at the single-cell level using fluorescent pH sensors, revealing heterogeneity in frequency, start time, stop time, duration, and amplitude across a population .

  • Changes in cytoplasmic pH appear to be both necessary and sufficient to drive changes in NADH levels, suggesting that pH oscillations may be a fundamental component of metabolic cycling .

The potential role of Rim21 in these processes remains an open question. Research suggests that cells exhibiting glycolytic oscillations have lower mitochondrial membrane potentials and bud more slowly than non-oscillators, indicating physiological consequences of these pH dynamics . Investigating whether Rim21 participates in sensing or regulating these oscillations could reveal new functions for this protein beyond its established role in external pH adaptation.

How do mutations in the EEE motif of Rim21C mechanistically impair pH sensing?

The triple glutamate (EEE) motif in Rim21C is essential for its function, but the precise molecular mechanism remains under investigation. Current hypotheses include:

  • Electrostatic sensing model: The negatively charged EEE motif may interact with positively charged membrane components, with these interactions being disrupted by changes in membrane potential during alkalization or lipid asymmetry alterations .

  • Conformational switch model: The EEE motif might undergo conformational changes in response to environmental signals, altering its interaction with downstream components of the pathway .

  • Protein-protein interaction hub: The EEE motif could serve as a binding site for other proteins in the Rim101 pathway, with its availability for interaction being regulated by membrane association .

To distinguish between these possibilities, researchers could employ:

  • Molecular dynamics simulations to model electrostatic interactions

  • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

  • Cross-linking studies combined with mass spectrometry to identify interaction partners

What are the physiological consequences of impaired Rim21 function under alkaline stress?

When S. cerevisiae is exposed to high environmental pH (8.0-9.0), several physiological changes occur that may be linked to Rim21 function:

  • Growth inhibition: Growth of S. cerevisiae stops when the medium pH is maintained at 8.0 or 9.0 .

  • Metabolic adjustments: Fermentation is moderately decreased at high pH, while respiration remains similar to that at neutral pH and remains sensitive to uncouplers .

  • Cell cycle arrest: The cell cycle stops at pH 9.0, likely due to adjustments needed by cells to contend with these conditions .

  • Transcriptional reprogramming: Microarray experiments show relevant changes in gene expression in response to high pH .

Surprisingly, many basic physiological functions remain intact under alkaline conditions:

  • ATP and glucose-6-phosphate levels increase normally upon glucose addition

  • Proton pumping and K+ transport are not significantly affected

  • Amino acid transport and incorporation into proteins remain largely functional

This suggests that growth inhibition at high pH is not due to energy limitation or general transport defects, but rather to specific regulatory responses, potentially mediated through the Rim101 pathway and Rim21 .

How does Rim21 compare to pH sensors in other fungal species?

Comparative analysis between Rim21 in S. cerevisiae and pH sensors in other fungi reveals important evolutionary insights:

  • In Aspergillus nidulans, the integral membrane protein PalH is considered to be the pH sensor molecule analogous to Rim21 .

  • PalH localizes predominantly to the plasma membrane when co-overexpressed with PalI (the A. nidulans counterpart of Rim9), suggesting that PalI assists in plasma membrane localization of PalH, similar to the relationship between Rim21 and Rim9 in yeast .

  • Sequence homology between these proteins is relatively low, with Rim21 showing only 27% homology to PalH and Dfg16 showing 19% homology .

This divergence suggests that while the general mechanism of pH sensing through membrane proteins is conserved across fungal species, the specific molecular details may have evolved differently. Understanding these similarities and differences could provide insights into the evolution of environmental sensing mechanisms and may have implications for developing targeted antifungal treatments against pathogenic species.

What experimental challenges must be overcome to fully characterize the Rim21 sensing mechanism?

Despite significant progress, several experimental challenges remain in fully elucidating Rim21 function:

  • Membrane protein structure determination: As an integral membrane protein, Rim21's full structure has not been determined. Advanced structural biology techniques such as cryo-electron microscopy or X-ray crystallography of membrane proteins remain challenging but would provide valuable insights into sensing mechanisms .

  • Real-time tracking of conformational changes: Current technologies limit our ability to observe the dynamic structural changes that likely occur during sensing events. Development of advanced FRET-based sensors or other methods to monitor protein conformation in living cells would address this limitation .

  • Reconstitution in artificial systems: Reconstituting Rim21 and its partners in synthetic membranes or lipid bilayers would allow precise control of membrane composition, potential, and pH, enabling detailed biophysical studies of the sensing mechanism .

  • Single-molecule analysis: Single-molecule techniques could reveal heterogeneity in Rim21 behavior that may be masked in population-level studies, particularly given the observed heterogeneity in cellular pH responses .

Addressing these challenges will require interdisciplinary approaches combining expertise in membrane protein biochemistry, biophysics, and advanced imaging technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.