Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Saccharomyces cerevisiae Pheromone α-Factor Receptor (STE2) is a genetically engineered form of the native STE2 protein, a G protein-coupled receptor (GPCR) critical for mating in the budding yeast S. cerevisiae. STE2 is expressed exclusively in MATa haploid cells, where it binds α-factor pheromones secreted by MATα cells, initiating a signaling cascade that triggers cell cycle arrest, chemotropic growth, and fusion with a mating partner . Recombinant STE2 enables detailed biochemical and structural studies by allowing overexpression, purification, and functional characterization .

Pheromone Binding and Activation

  • α-factor binding induces conformational changes in STE2, enabling GDP-to-GTP exchange in the associated Gα subunit (Gpa1) .

  • This activates a mitogen-activated protein kinase (MAPK) cascade, leading to transcriptional changes (e.g., FUS1 induction) and mating-specific morphogenesis .

Signal Termination and Receptor Trafficking

  • Phosphorylation: STE2’s cytoplasmic tail is phosphorylated post-activation, promoting ubiquitination by Rsp5 E3 ligase .

  • Ubiquitination: K63-linked polyubiquitin tags direct clathrin-mediated endocytosis and vacuolar degradation .

  • Regulatory proteins: α-arrestins (Ldb19, Rod1, Rog3) mediate receptor internalization and sorting .

Recombinant STE2 Expression and Purification

  • A plasmid system enabled overexpression of STE2 tagged with FLAG/His6, yielding ~1 mg of purified receptor from 60 g of yeast cells .

  • Reconstituted STE2 retained ligand-binding activity (KD=155 nMK_D = 155\ \text{nM} for α-factor) .

Evolutionary Insights from Mutagenesis

  • Laboratory-evolved STE2 mutants acquired sensitivity to foreign pheromones (e.g., Candida glabrata α-factor) via two pathways:

    • Classical: Enhanced ligand-binding affinity .

    • Network-altering: Truncations in the cytoplasmic tail reduced RGS (Sst2) interactions, increasing signaling sensitivity .

Model for GPCR Studies

  • STE2’s simplicity and genetic tractability make it a paradigm for understanding GPCR signaling, desensitization, and evolution .

Biotechnology and Pathogen Control

  • Chemotropism in pathogens: Fusarium graminearum STE2 homolog mediates chemotropic responses to host signals, influencing pathogenicity .

  • Drug discovery: STE2’s structural insights inform GPCR-targeted therapeutic design .

Table 1: Functional Mutations in STE2

Mutation TypeEffectStudy
N388S (C-terminal)Reduced Gα/Gβ interaction, impaired mating
TruncationsDisrupted RGS binding, heightened signaling
Extracellular loopAltered ligand specificity

Table 2: Key Recombinant STE2 Studies

Study FocusMethodOutcomeReference
High-yield purificationFLAG/His6 tagging + affinity chromatography95% pure STE2 with retained activity
Evolutionary trajectoriesDirected evolution + selectionNetwork-altering mutations bypass ligand affinity
Cryo-EM structureSingle-particle analysisDimer architecture with dual G-protein coupling

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preference for a particular tag type, please inform us and we will prioritize its inclusion in the development process.
Synonyms
STE2; YFL026W; Pheromone alpha factor receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
STE2
Target Protein Sequence
MSDAAPSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVRCG AAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVTYALTGFPQFI SRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDNFKRIGLMLTSISFTLGIATVTM YFVSAVKGMIVTYNDVSATQDKYFNASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQ FDSFHILLIMSCQSLLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAAN NASKTNTITSDFTTSTDRFYPGTLSSFQTDSINNDAKSSLRSRLYDLYPRRKETTSDKHS ERTFVSETADDIEKNQFYQLPTPTSSKNTRIGPFADASYKEGEVEPVDMYTPDTAADEEA RKFWTEDNNNL
Uniprot No.

Target Background

Function
This protein serves as the receptor for the peptide pheromone alpha factor, the mating factor in yeast.
Gene References Into Functions
  1. Interaction between Ste2p and Gpa1p occurs prior to ligand binding, facilitated by the Ste2p C-terminal domain and the Gpa1p N-terminal domain. PMID: 28958779
  2. The yeast pheromone receptor Ste2 predominantly forms tetramers at average expression levels ranging from 2 to 25 molecules per pixel. At expression levels between 25-100 molecules per pixel, a mixture of tetramers and octamers is observed. Ste2 is classified as a class D GPCR found in the yeast Saccharomyces cerevisiae of the mating type a. It binds the pheromone a-factor secreted by cells of the mating type a. PMID: 27993568
  3. A notable distinction between the Ste2 and Ste3 receptors is the identification of hyperactive mutations for Ste3, while no gain-of-function mutants were found for the Ste2 receptor. This finding is attributed to the distinct expression strategies adopted by the two genes. PMID: 27150158
  4. Research indicates that the G-protein-coupled receptor, Ste2, interacts with the inhibitory G-protein signaling component, Sst2, forming a complex with antagonistic functions. PMID: 28034910
  5. Findings reveal a variable dependence of signaling output on agonist occupancy of Ste2p, a G Protein-coupled Receptor in yeast. PMID: 27646004
  6. These results expand upon previous observations and provide quantitative insights into the contributions of Ste2p variants in mediating cell cycle arrest versus downstream mating functionalities. PMID: 26232403
  7. Our findings propose that the N-terminus of Ste2p plays multiple regulatory roles in controlling receptor function. PMID: 26707753
  8. This study outlines a strategy for identifying stabilized variants of the yeast alpha-factor receptor Ste2p. PMID: 25647246
  9. Research shows that Ste2 is downregulated by endocytosis, both constitutively and ligand-induced. Its internalization requires phosphorylation and ubiquitinylation mediated by alpha arrestins. PMID: 24820415
  10. C-terminally truncated forms of Ste2p exhibit dominant-negative effects. PMID: 22923047
  11. This study focuses on the structure determination of transmembrane segments of Y4 and the yeast Ste2p G-protein-coupled receptors. PMID: 22947943
  12. The identification of disulfide bonds that stabilize the active state of the yeast alpha-mating pheromone receptor Ste2p. PMID: 22387470
  13. The C-terminus of Ste2p comprises multiple functional domains with differential and interdependent roles in regulating its function. PMID: 22100461
  14. A cryptic polyadenylation site is present within the coding region of the a-specific STE2 gene, encoding the receptor for the alpha-factor. PMID: 21969566
  15. This research provides new information about the role of specific residues in STE2, a GPCR, in signal transduction and how peptide ligand binding activates the receptor. PMID: 21728340
  16. These results suggest that receptor-agonist interactions, such as those involving Ste2p, involve at least two sites, of which only one is specific for the activated conformation of the receptor. PMID: 21477594
  17. Kinetic analysis suggests that alpha-factor associates with its receptor STE2 via a two-stage process consisting of an initial binding event followed by a rearrangement of the ligand-receptor complex. PMID: 15491163
  18. Thirty-five distinct STE2 suppressor mutations were identified by isolating second-site suppressor mutations that restored function to defective receptors carrying either an F204S or Y266C substitution. PMID: 15667221
  19. NMR analysis revealed the presence of helical subdomains in both the transmembrane and cytosolic tail. As the tail participates in down-regulation of Ste2p, helical regions in the tail may play a role in protein-protein interactions during endocytosis. PMID: 16128581
  20. This research demonstrates an interaction between specific residues in an active state, but not the resting state, of Ste2p. PMID: 16314417
  21. Findings indicate that G protein signaling and homologous desensitization are independent cellular processes. PMID: 16325780
  22. TEDS site phosphorylation of the yeast myosins I is required for ligand-induced but not for constitutive endocytosis of Ste2p. PMID: 16478726
  23. Signal transduction by oligomeric Ste2p receptors appears to be a cooperative process requiring an interaction between functional monomers. PMID: 16709573
  24. Amino acid residues of Ste2 that are accessible to the cytoplasmic G-protein are defined. These findings provide a valuable structural framework for interpreting the role of Ste2 residues that function in G-protein activation. PMID: 17176053
  25. An interaction between Ste2p and Ste3p plays a role in yeast cellular mating. PMID: 17369365
  26. The presence of an alpha-helix in the segment encompassing residues 10-30 is perturbed around the internal Pro-24 residue. PMID: 17449670
  27. This research lays the groundwork for determining the 3D structure of these large domains of a G protein-coupled receptor in micelles using high-resolution NMR. PMID: 18260136
  28. Alpha-Factor induced stabilization of the dimeric form and higher order oligomeric forms of the Ste2p receptor. PMID: 18996443
  29. This study is the first to report DOPA cross-linking of a peptide hormone to a GPCR and the first to identify a residue-to-residue cross-link between Ste2p and alpha-factor, thereby defining a specific contact point between the bound ligand and its receptor. PMID: 19152328
  30. A high-resolution NMR study on an 80-residue fragment of Ste2p. The data supports a stable fold for the TM parts of TM1-TM2. The NMR structure aligns with biochemical experiments that identified the ligand-binding site within this region of the receptor. PMID: 19383463
  31. Results support the conclusion that G protein-coupled receptors, including Ste2, form oligomers, not just dimers, as TM1 and TM4 are too far apart in class A GPCRs to form contacts in the same dimer moiety. PMID: 19588927
  32. The effect of ligand (alpha-factor) on dimer formation of STE2 suggests that dimers are formed in both the resting state and the activated state of the receptor through different transmembrane interactions. PMID: 19839649

Show More

Hide All

Database Links

KEGG: sce:YFL026W

STRING: 4932.YFL026W

Protein Families
G-protein coupled receptor 4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the STE2 gene and what does it encode in Saccharomyces cerevisiae?

The STE2 gene in Saccharomyces cerevisiae encodes a component of the receptor for the oligopeptide pheromone alpha-factor. It contains an open reading frame that encodes a protein of 431 amino acids. The predicted STE2 protein contains seven hydrophobic segments, suggesting that the alpha-factor receptor is an integral membrane protein. This receptor is essential for the mating process, allowing a-type cells to detect the presence of α-factor produced by α cells . The STE2 gene is specifically expressed in a-type cells, with a sequence involved in the control of cell-type expression found in the 5' region of the gene .

How is STE2 classified among G protein-coupled receptors?

STE2 is classified as a Class D GPCR, which is found exclusively in fungi. Recent structural studies have revealed that while it shares some similarities with GPCRs in Classes A, B, C, and F, it also exhibits significant differences, such as in the position of transmembrane helix 4 (H4) . To facilitate comparative analysis, a specialized Class D1 numbering system (CD1) has been developed analogous to the Ballesteros-Weinstein, Wootten, Pin, and Wang systems for other GPCR classes. In this system, the most conserved amino acid residue in each transmembrane α-helix is given the number Yx50, where Y is the helix number .

How is STE2 expression regulated in different yeast mating types?

The regulation of STE2 expression is a complex process involving both transcriptional and post-transcriptional mechanisms:

Characteristica cellsα cells
Short STE2 transcriptProducedProduced
Full-length STE2 mRNAProducedNot produced
Transcriptional repressionMinimalStrong (via ITC1/ISW2)
Early poly(A) site usageLowHigh
Functional receptorPresentAbsent

In Saccharomyces cerevisiae, STE2 expression is cell-type specific. Both a and α cells produce an incomplete STE2 transcript, but only a cells generate the full-length STE2 mRNA. In α cells, STE2 expression is repressed at the transcriptional level by the ITC1 gene product together with ISW2 . Additionally, a cryptic polyadenylation site within the STE2 coding region leads to premature termination of transcription in α cells, preventing the production of functional receptor and avoiding autocrine activation .

What is the significance of the cryptic polyadenylation site in STE2?

The cryptic polyadenylation site within the STE2 coding region serves as a regulatory mechanism to prevent expression of the complete receptor in α cells, thereby avoiding autocrine activation and inappropriate growth arrest. Upstream of this early poly(A) site is a putative recognition region rich in A and T/U nucleotides (positions 287-316) . This regulatory mechanism contributes to the complete shutdown of STE2 expression in α cells, which is critical because inappropriate expression could lead to activation of the mating pathway in these cells. Interestingly, no similar cryptic poly(A) sites are present in the a-factor receptor STE3 gene, indicating that S. cerevisiae has evolved different strategies to regulate the two receptor genes .

How can mutations in the cryptic poly(A) site of STE2 be generated and analyzed?

To study the role of the cryptic poly(A) site in STE2 regulation, researchers can employ the following methodology:

  • Identify the putative recognition region upstream of the early poly(A) site (positions 287-316 in STE2)

  • Design primers to introduce mutations at key positions within this A/T-rich region

  • Perform site-directed mutagenesis to create the desired mutations

  • Introduce the mutated STE2 gene into a suitable strain (e.g., MATα strain with STE2, STE3, and FAR1 deletions, containing a reporter gene like FUS1-lacZ)

  • Analyze the resulting transcripts using RT-PCR to detect the presence of full-length STE2 mRNA

  • Quantify the activation of the mating pathway using a β-galactosidase assay to measure the induction of the reporter gene

When the early poly(A) recognition site is mutated, α cells can produce the full-length STE2 transcript, resulting in activation of the mating pathway as indicated by increased β-galactosidase activity from the FUS1-lacZ reporter .

What methods can be used to isolate mutants with altered STE2 expression?

A genetic approach to identify genes involved in regulating STE2 polyadenylation can be implemented as follows:

  • Use a strain that would display a detectable phenotype when STE2 is fully expressed (e.g., a MATα strain with a FUS1-lacZ reporter that turns blue on X-Gal plates when the mating pathway is activated)

  • Mutagenize the strain using UV light or chemical mutagens

  • Plate the mutagenized cells on X-Gal plates and screen for blue colonies, indicating activation of the mating pathway

  • Confirm that the observed phenotype is dependent on STE2 by comparing cells with and without the STE2 gene

  • Perform RT-PCR analysis to identify mutants with altered STE2 transcript patterns

  • Conduct S1 nuclease assays to determine if both short and long transcripts are present

  • Sequence the mutant strains to identify the causative mutations

This approach has successfully identified mutations in genes like ITC1 that, when mutated, allow α cells to produce full-length STE2 transcripts and activate the mating pathway .

How does the alpha-factor interact with the STE2 receptor?

The interaction between α-factor and the STE2 receptor involves residues throughout the extracellular half of the receptor, with specific regions of the peptide making different contacts:

Alpha-factor regionPercentage of contactsSTE2 regions involved
N-terminal Trp1MinimalOutside orthosteric binding pocket
His2-Trp3-Leu438%H5, H6, ECL3
Central region27%Various regions
Pro11-Met12-Tyr1335%H1, H2, ECL1, H3, H4

The N-terminal Trp1 of α-factor resides mainly outside the orthosteric binding pocket. His2-Trp3-Leu4 contribute 38% of the ligand-receptor contacts, primarily interacting with residues in transmembrane helices 5 and 6 and extracellular loop 3. The C-terminal domain (Pro11-Met12-Tyr13) accounts for another 35% of the contacts, mainly with residues in helices 1, 2, 3, 4, and extracellular loop 1. Studies have shown that mutations in 23 out of 31 residues in STE2 that make contacts with α-factor significantly affect ligand binding and/or signaling .

What structural features distinguish STE2 from other classes of GPCRs?

STE2 exhibits several unique structural features compared to other GPCR classes:

FeatureClass D (STE2)Other GPCR Classes
OligomerizationForms homodimerVaries by class (mostly monomeric in A and B, dimeric in C)
G protein couplingCouples to two G proteins simultaneouslyTypically one G protein per receptor or dimer
Transmembrane helix arrangementDistinctive position of H4Different arrangements depending on class
Activation mechanismNovel mechanism with unique intermediate statesClass-specific mechanisms

Recent cryo-EM studies have revealed that STE2 has a structural and activation mechanism distinct from all previously determined monomeric GPCRs. STE2 forms a homodimer and couples to two G proteins (Gpa1-Ste4-Ste18) simultaneously. Four distinct conformational states have been identified: a ligand-free state, an antagonist-bound state, and two agonist-bound intermediate states . This novel activation mechanism highlights the evolutionary diversity of GPCR signaling systems across different kingdoms of life.

How can the unique activation mechanism of STE2 be studied?

To investigate the activation mechanism of STE2, researchers can employ the following methodology:

  • Purify STE2 under different ligand conditions to capture various conformational states:

    • Ligand-free state using the PSGWAY method (pre-stabilization by weak association with G proteins)

    • Antagonist-bound state using appropriate antagonist peptides

    • Agonist-bound intermediate states using agonist peptides

  • Perform cryo-EM analysis to determine the structures of these different states

    • Collect large datasets (>30,000 micrographs)

    • Process the data computationally to determine high-resolution structures

  • Compare the structural changes between states to elucidate the activation pathway

    • Analyze changes in transmembrane helix positions

    • Identify key residues involved in the transition between states

    • Examine the interface between receptor and G protein

  • Validate structural findings with functional studies

    • Site-directed mutagenesis of key residues

    • Signaling assays to measure G protein activation

    • Ligand binding studies to assess affinity changes

This approach has successfully revealed that STE2 has a distinct activation mechanism from mammalian GPCRs, providing insights into fungal GPCR function .

How do different variants of GPCR receptors affect signaling properties?

Variations in GPCR structure can significantly impact signaling properties, as demonstrated by comparative studies of receptor variants:

  • Different isoforms may show distinct signaling kinetics:

    • 'Long' and 'short' forms of receptors (like rat sst2a and sst2b) can exhibit markedly different signaling profiles

    • The 'long' form (rsst2a) shows transient responses with significant desensitization and receptor phosphorylation

    • The 'short' form (rsst2b) demonstrates prolonged responses without significant desensitization or phosphorylation

  • Species-specific differences can affect ligand binding and signaling:

    • Human and rat variants of the same receptor may have different agonist potencies

    • Antagonist binding affinities can vary between species (e.g., CYN154806 antagonizes hsst2a and rsst2a receptors with pKB values of 7.9 and 7.8, respectively)

  • The C-terminal region often plays a critical role in:

    • Receptor desensitization mechanisms

    • Interaction with intracellular signaling molecules

    • Receptor internalization and trafficking

These principles derived from studies of other GPCRs can be applied to understand how different variants or mutations of STE2 might affect its signaling properties in different contexts or fungal species.

What considerations are important when designing experiments to study STE2?

When designing experiments to investigate STE2, researchers should consider the following methodological principles:

  • Ensure the research question is clear and focused

    • Questions should not be answerable with a simple "yes" or "no"

    • Questions should require both research and analysis

    • Questions should be of academic and intellectual interest to people in the field

  • Ensure feasibility and manageability

    • Consider available time frame and required resources

    • Ensure methodology to conduct the research is feasible

    • Question should be measurable and produce data that can be supported or contradicted

  • Formulate appropriate hypotheses

    • Create specific predictions about the nature and direction of relationships between variables

    • Consider what it would mean if the research disputed the planned argument

    • Understand the implications of the research for filling gaps in knowledge

  • Select appropriate study design based on the research question

    • Different questions require different experimental approaches

    • Define subject inclusion/exclusion criteria and time frame carefully

    • Calculate appropriate sample sizes using statistical methods

These considerations will help ensure that research on STE2 is well-designed, relevant, and generates meaningful results that advance our understanding of this important fungal receptor.

What are promising future research directions for STE2 studies?

Based on current knowledge and recent discoveries, several promising research directions for STE2 include:

  • Detailed mapping of the complete activation pathway

    • Identifying additional intermediate conformational states

    • Understanding the energetics of the conformational changes

    • Elucidating the precise mechanism of G protein coupling and activation

  • Comparative studies across fungal species

    • Investigating STE2 homologs in pathogenic fungi

    • Understanding evolutionary conservation and divergence of fungal GPCRs

    • Identifying unique features that could be targeted for antifungal development

  • Investigation of STE2 regulation across different conditions

    • Exploring post-translational modifications that affect receptor function

    • Understanding trafficking and localization of the receptor

    • Studying cross-talk with other signaling pathways

  • Application of insights from STE2 to understand other Class D GPCRs

    • Using the CD1 numbering system to facilitate cross-receptor comparisons

    • Identifying common activation mechanisms in fungal GPCRs

    • Leveraging structural insights to predict functions of uncharacterized fungal GPCRs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.