Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit (SPT14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
SPT14; SCY_5555; Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit; GlcNAc-PI synthesis protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
SPT14
Target Protein Sequence
MGFNIAMLCDFFYPQLGGVEFHIYHLSQKLIDLGHSVVIITHAYKDRVGVRHLTNGLKVY HVPFFVIFRETTFPTVFSTFPIIRNILLREQIQIVHSHGSASTFAHEGILHANTMGLRTV FTDHSLYGFNNLTSIWVNKLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAV VSEDFKPRDPTDSTKRKQSRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAG DGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAAS CNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAINIIRSKALDTSSFHDSVSK MYDWMDVAKRTVEIYTNISSTSSADDKDWMKMVANLYKRDGIWAKHLYLLCGIVEYMLFF LLEWLYPRDEIDLAPKWPKKSVSNETKEARET
Uniprot No.

Target Background

Function

Function: This protein functions as the catalytic subunit within a complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol. This is the initial step in glycosylphosphatidylinositol (GPI) biosynthesis.

Protein Families
Glycosyltransferase group 1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the SPT14/GPI3 gene in Saccharomyces cerevisiae and what is its function?

SPT14/GPI3 in Saccharomyces cerevisiae encodes a catalytic subunit of the UDP-glycosyltransferase complex, which catalyzes the first step in glycosylphosphatidylinositol (GPI) anchor biosynthesis . Specifically, this enzyme transfers N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI) to generate N-acetylglucosaminyl-PI (GlcNAc-PI) . This initial step is critical for the entire GPI biosynthesis pathway, which ultimately leads to the creation of GPI anchors that tether various proteins to cell membranes. Mutations in SPT14 result in defective GPI anchoring, which can lead to several cellular abnormalities including transcriptional defects and disruptions in inositolphosphoceramide synthesis .

How does SPT14/GPI3 in yeast relate to human proteins and disease?

The yeast SPT14 gene shows remarkably high sequence similarity to the human protein PIG-A (Phosphatidylinositol Glycan Anchor Biosynthesis Class A) . This homology is significant because mutations in human PIG-A are responsible for paroxysmal nocturnal hemoglobinuria (PNH), a disease characterized by the loss of cell surface GPI-anchored proteins . Like SPT14 mutants in yeast, PIG-A mutant cells in humans are defective in GPI anchoring due to impaired synthesis of GlcNAc-PI. This conservation between species makes S. cerevisiae SPT14 an excellent model system for studying the fundamental aspects of GPI biosynthesis and understanding the molecular basis of human diseases related to GPI anchor deficiencies .

What is the composition of the GPI-N-acetylglucosaminyl transferase (GPI-GnT) complex containing SPT14/GPI3?

The GPI-N-acetylglucosaminyl transferase (GPI-GnT) that includes SPT14/GPI3 is unusually complex for a glycosyltransferase. Unlike many enzymes that function as single proteins, this transferase operates as a multi-subunit complex. In S. cerevisiae, SPT14/GPI3 functions within a complex that includes other proteins such as GPI1, GPI2, and GPI15 . The human equivalent consists of at least four proteins: PIG-A (homologous to yeast SPT14), PIG-H, PIG-C, and GPI1 .

Research has identified additional components and regulatory factors of this complex. For instance, another component termed PIG-P (a 134-amino acid protein with two hydrophobic domains) associates with PIG-A and GPI1 and is essential for GPI-GnT function . Furthermore, DPM2, a protein that regulates dolichol-phosphate-mannose synthase, also regulates GPI-GnT activity through interactions with multiple complex components (PIG-A, PIG-C, and GPI1), enhancing enzyme activity approximately 3-fold .

What are the standard approaches for expressing and purifying recombinant SPT14/GPI3 from S. cerevisiae?

Expression Systems Selection:

Recombinant SPT14/GPI3 expression typically employs standard yeast expression vectors with selection markers. Common growth conditions include cultivation in yeast-peptone (YP) medium supplemented with 10 g/L yeast extract, 20 g/L bacteriological peptone, and 0.33 g/L of L-tryptophan. Carbon sources are added after autoclave sterilization at concentrations of 2% dextrose (YPD) for optimal growth .

Purification Protocol:

  • Transform S. cerevisiae with an expression vector containing SPT14/GPI3 with an affinity tag (often His6 or GST)

  • Grow transformants in appropriate selection media (often using drug selection with G418, NAT, or HYG)

  • Confirm successful transformation via PCR

  • Lyse cells under conditions that preserve membrane protein structure (as SPT14 is associated with the ER membrane)

  • Solubilize membrane fractions using mild detergents

  • Purify using affinity chromatography based on the fusion tag

  • Verify purification via SDS-PAGE and Western blotting

Critical Considerations:

  • SPT14/GPI3 functions as part of a multi-protein complex; consider co-expression strategies with GPI1, GPI2, GPI15, or other complex components

  • Verification of activity typically requires in vitro assays measuring transfer of N-acetylglucosamine from UDP-GlcNAc to phosphatidylinositol

How can SPT14/GPI3 mutations be generated and characterized for functional studies?

Generation of SPT14/GPI3 Mutants:

  • Site-Directed Mutagenesis: Create specific point mutations such as H106Y, V76F, or T144A, which have been identified in jawsamycin resistance studies .

  • Deletion Mutants: Utilize the S. cerevisiae deletion mutant array (DMA) to obtain SPT14 deletion strains .

  • CRISPR-Cas9 Genome Editing: For precise modification of the SPT14 genomic locus.

  • Plasmid Shuffle Technique: For studying lethal mutations in essential genes like SPT14.

Characterization Methods:

  • Growth Phenotype Analysis: Compare growth rates of mutant strains with wild-type under various conditions. Complete SPT14 deletion is typically lethal, but partial function mutations show characteristic growth defects.

  • Inhibitor Sensitivity Testing: Analyze dose-response curves for antifungal compounds like jawsamycin. For example, the H106Y, V76F, and T144A mutations in SPT14 confer 10-100 fold increases in IC50 values for jawsamycin without affecting sensitivity to unrelated compounds like clotrimazole . This can be represented as:

    SPT14 VariantJawsamycin IC50 Fold ChangeClotrimazole IC50 Fold Change
    Wild-type1× (reference)1× (reference)
    H106Y10-100×
    V76F10-100×
    T144A10-100×
  • Biochemical Activity Assays: Measure the transfer of N-acetylglucosamine from UDP-GlcNAc to phosphatidylinositol in cell extracts or with purified components.

  • Analysis of GPI-Anchored Proteins: Determine the impact of mutations on the presence and abundance of GPI-anchored proteins at the cell surface.

  • Structural Studies: Use purified mutant proteins for crystallography or cryo-EM studies to determine how mutations affect protein structure and function.

How does SPT14/GPI3 function within the larger context of fungal GPI biosynthesis pathways?

SPT14/GPI3 catalyzes the critical first step in GPI biosynthesis, but understanding its role requires contextualizing it within the complete pathway. The GPI biosynthesis pathway in fungi involves multiple sequential enzymatic reactions:

  • Initial GlcNAc Transfer (SPT14/GPI3-mediated): Transfer of N-acetylglucosamine from UDP-GlcNAc to phosphatidylinositol, forming GlcNAc-PI .

  • De-N-acetylation: Removal of the acetyl group to form glucosaminyl-PI.

  • Inositol Acylation: Addition of an acyl chain to the inositol ring.

  • Mannose Addition: Sequential addition of mannose residues from dolichol-phosphate-mannose.

  • Phosphoethanolamine Addition: Addition of phosphoethanolamine to mannose residues.

  • GPI Transamidase Action: Transfer of the completed GPI anchor to proteins.

SPT14/GPI3 functions within a complex containing multiple subunits (GPI1, GPI2, GPI15) . This complex is regulated by factors such as DPM2, which also regulates dolichol-phosphate-mannose synthase, suggesting coordinated regulation between GPI anchor synthesis and other glycosylation pathways .

Disruptions in SPT14/GPI3 function not only prevent GPI anchor formation but also affect:

  • Inositolphosphoceramide synthesis

  • Transcriptional processes

  • Cell wall integrity

  • Stress responses

  • Virulence in pathogenic fungi

These wider effects highlight the integration of GPI biosynthesis with other cellular processes and explain why SPT14/GPI3 inhibitors like jawsamycin show promise as antifungal agents .

What are the structural and functional differences between S. cerevisiae SPT14/GPI3 and its human homolog PIG-A?

Despite high sequence similarity, critical differences exist between S. cerevisiae SPT14/GPI3 and human PIG-A that can be exploited for antifungal development. Comparing these proteins reveals:

Sequence and Structural Differences:

Functional Context Differences:

  • Yeast SPT14/GPI3 functions within a complex containing GPI1, GPI2, and GPI15

  • Human PIG-A operates in a complex with PIG-H, PIG-C, and GPI1, plus the additional component PIG-P

  • Regulatory mechanisms differ; for example, DPM2 enhances GPI-GnT activity approximately 3-fold in the human system

Inhibitor Sensitivity:

  • Jawsamycin selectively inhibits fungal SPT14/GPI3 with minimal effects on human PIG-A

  • This selectivity provides a therapeutic window for antifungal development

Comparative IC50 Values for Jawsamycin:

OrganismEnzymeIC50 (μM)Relative Sensitivity
S. cerevisiaeSPT14/GPI3LowerHigh
HumanPIG-AHigherLow

These differences provide the molecular basis for developing selective inhibitors that target fungal GPI biosynthesis without disrupting the human pathway, an essential consideration for antifungal therapeutics .

How can SPT14/GPI3 be utilized as a target for antifungal drug development?

The essential nature of SPT14/GPI3 for fungal viability, combined with structural differences from its human homolog, makes it an excellent target for selective antifungal development. Research into SPT14/GPI3 inhibitors has yielded several strategic approaches:

Target Validation Approaches:

  • Genetic Validation: SPT14/GPI3 essentiality has been established through deletion studies in S. cerevisiae and other fungi .

  • Chemical Validation: The natural product jawsamycin has validated SPT14/GPI3 as a druggable target with demonstrated in vivo efficacy .

Lead Compound Development:

  • Natural Product Exploitation: Jawsamycin (FR-900848), an oligocyclopropyl-containing natural product, potently inhibits SPT14/GPI3 with good selectivity over human PIG-A .

  • Structure-Activity Relationship Studies: A focused set of jawsamycin analogs has demonstrated tight structure-activity relationships against pathogenic fungi .

Resistance Mechanisms:
Resistant mutants (H106Y, V76F, T144A) identified through unbiased mutagenesis screens provide critical insights into the binding pocket and potential resistance mechanisms, informing rational drug design efforts .

In Vivo Efficacy:
Jawsamycin has demonstrated antifungal activity in vitro against several pathogenic fungi including Mucorales, and in vivo efficacy in a mouse model of invasive pulmonary mucormycosis due to Rhizopus delemar infection .

Development Pathway:

  • Identify lead compounds through phenotypic screening

  • Validate SPT14/GPI3 as the molecular target

  • Optimize lead compounds for potency, selectivity, and pharmacokinetic properties

  • Evaluate in vitro activity against relevant fungal pathogens

  • Assess in vivo efficacy in animal models of fungal infection

  • Develop resistance mitigation strategies based on mutation analysis

This approach has positioned SPT14/GPI3 inhibitors as promising candidates for addressing the critical need for novel antifungal agents with unique mechanisms of action .

How conserved is the SPT14/GPI3 protein across different fungal species compared to S. cerevisiae?

SPT14/GPI3 exhibits significant conservation across fungal species, reflecting the essential nature of GPI biosynthesis. Comparative analysis reveals interesting evolutionary patterns:

Conservation Among Yeasts:

  • Saccharomyces cerevisiae SPT14/GPI3 shares approximately 90% genome similarity with Candida albicans

  • Both organisms utilize similar GPI biosynthesis pathways with conserved catalytic components

Functional Conservation vs. Structural Divergence:
While the catalytic function is highly conserved, subtle structural differences exist between SPT14/GPI3 homologs across fungal species. These variations can be exploited for species-selective inhibitor development. For example, jawsamycin demonstrates varying potencies against different pathogenic fungi, including particularly strong activity against Mucorales .

Comparative Analysis Table of SPT14/GPI3 Across Fungal Species:

Fungal SpeciesHomolog NameKey Structural DifferencesJawsamycin Sensitivity
S. cerevisiaeSPT14/GPI3Reference structureHigh
C. albicansGPI3Minor variations in binding pocketHigh
MucoralesGPI3/SPT14Variations in conserved domainsVery high
Aspergillus spp.GPI3Moderate structural differencesModerate to high

This conservation pattern supports SPT14/GPI3 as a broad-spectrum antifungal target while allowing for the development of inhibitors with tailored species selectivity profiles .

What ecological and physiological roles does SPT14/GPI3 play in S. cerevisiae's ability to colonize diverse environments?

The GPI biosynthesis pathway facilitated by SPT14/GPI3 contributes significantly to S. cerevisiae's ecological adaptability:

Mucin Utilization:
While C. albicans can metabolize mucin (a major carbon source in the gut) through secreted aspartyl proteases (SAPs), S. cerevisiae possesses homologous proteases called yapsins . The yapsin proteins that share the most peptide sequence similarity to Candida SAPs are Yps1 and Yps3, which function optimally at pH 5-6, similar to the average pH in the human colon (pH 5-6) . These yapsins require proper GPI anchoring, dependent on SPT14/GPI3 function, to localize correctly at the cell surface.

Stress Adaptation:
GPI-anchored proteins contribute to cell wall integrity and stress responses, allowing S. cerevisiae to adapt to different environmental conditions, including:

  • Oxygen-limited environments

  • Acidic pH conditions

  • Nutrient-limited settings

  • Competitive microbial communities

Host Interaction:
S. cerevisiae has demonstrated both beneficial and detrimental effects in host interactions:

  • Reduction of colitis symptoms

  • Immunological stimulation that can overturn viral infections

  • Potential increase in intestinal damage and permeability in germ-free mice

These diverse ecological roles highlight why SPT14/GPI3 remains an essential gene and underscores its importance beyond basic cellular functions in enabling S. cerevisiae to thrive across varied environmental niches.

What new analytical techniques are advancing our understanding of SPT14/GPI3 structure and function?

Recent technological advances have enabled more sophisticated investigations of SPT14/GPI3:

Cryo-Electron Microscopy (Cryo-EM):
Cryo-EM has revolutionized structural biology of membrane protein complexes, allowing visualization of the entire GPI-GnT complex containing SPT14/GPI3 without crystallization. This technique has revealed previously unknown structural features and protein-protein interactions within the complex.

CRISPR-Based Functional Genomics:
CRISPR genome editing and screening approaches provide unprecedented precision in:

  • Creating specific SPT14/GPI3 mutations

  • Conducting genome-wide screens for genetic interactions

  • Identifying synthetic lethal partners

  • Mapping functional domains through saturating mutagenesis

Quantitative Proteomics:
Advanced mass spectrometry methods now enable:

  • Comprehensive profiling of GPI-anchored proteomes

  • Quantitative measurement of GPI anchor abundance and structure

  • Detection of subtle changes in GPI biosynthesis caused by mutations or inhibitors

  • Cross-linking mass spectrometry to map complex protein interactions

Single-Molecule Techniques:
Single-molecule approaches allow direct observation of SPT14/GPI3 enzyme kinetics and substrate interactions, revealing mechanistic details impossible to detect with bulk measurements.

Molecular Dynamics Simulations:
Computational approaches provide insights into:

  • SPT14/GPI3 conformational dynamics

  • Substrate binding mechanisms

  • Inhibitor interactions

  • Prediction of resistance-conferring mutations

These advances collectively provide a more comprehensive understanding of SPT14/GPI3 structure-function relationships and accelerate both fundamental research and translational applications targeting this essential enzyme.

How can SPT14/GPI3 research inform our understanding of S. cerevisiae in the human microbiome?

SPT14/GPI3 research offers valuable insights into the role of S. cerevisiae in the human microbiome:

Colonization Mechanisms:
GPI-anchored proteins mediated by SPT14/GPI3 enable S. cerevisiae to adhere to and potentially colonize the human gut mucosa . Understanding these mechanisms helps distinguish between transient dietary passage and true colonization of this yeast in the human microbiome.

Microbiome Interactions:
Research suggests that S. cerevisiae can metabolize mucin, a major carbon source in the gut mucosa . The GPI-anchored yapsins (Yps1, Yps2, Yps3) involved in this process depend on SPT14/GPI3 for proper localization and function. These proteases are active at pH 5-6, compatible with the human colon environment .

Comparative Analysis with Pathogenic Fungi:
S. cerevisiae shares approximately 90% genome similarity with the opportunistic pathogen Candida albicans . SPT14/GPI3 research provides a framework for understanding the molecular distinctions that determine commensal versus pathogenic behavior in the gut microbiome.

Immunomodulatory Effects:
S. cerevisiae has demonstrated both beneficial and detrimental effects on host health:

  • Reduction of colitis symptoms and viral infections through immunological stimulation

  • Potential increase in intestinal damage and permeability in germ-free mice

The cell surface composition governed by SPT14/GPI3 likely plays a crucial role in these immunomodulatory effects.

Future Research Directions:

  • Development of SPT14/GPI3 conditional mutants to study colonization dynamics in vivo

  • Comparative analysis of GPI-anchored proteomes between laboratory and wild S. cerevisiae strains

  • Investigation of how dietary and environmental factors influence SPT14/GPI3 expression and function

  • Exploration of SPT14/GPI3 inhibitors as potential modulators of fungal microbiome composition

This research area represents an emerging frontier connecting molecular genetics, biochemistry, microbiology, and human health.

What are common challenges and solutions when working with SPT14/GPI3 in experimental systems?

Challenge 1: Lethality of Complete SPT14/GPI3 Deletion

  • Problem: Complete deletion of SPT14/GPI3 is lethal, complicating genetic studies.

  • Solutions:

    • Use temperature-sensitive or conditional alleles

    • Employ plasmid shuffle techniques with URA3-based counterselection

    • Create partial loss-of-function mutations

    • Use chemical inhibitors like jawsamycin at sub-lethal concentrations

Challenge 2: Membrane Protein Expression and Purification

  • Problem: SPT14/GPI3 is an ER membrane-associated protein, making purification difficult.

  • Solutions:

    • Optimize detergent selection for solubilization

    • Consider nanodiscs or amphipols for stabilization

    • Purify entire GPI-GnT complex rather than individual components

    • Use GFP fusion strategies for monitoring localization and expression

Challenge 3: Complex Formation Requirements

  • Problem: SPT14/GPI3 functions within a multi-component complex, complicating in vitro studies.

  • Solutions:

    • Co-express SPT14/GPI3 with GPI1, GPI2, and GPI15 partners

    • Use tandem affinity purification to isolate intact complexes

    • Consider cell-free expression systems for controlled complex assembly

Challenge 4: Activity Assay Development

  • Problem: Measuring GlcNAc-PI synthesis requires specialized assays.

  • Solutions:

    • Use radiolabeled UDP-GlcNAc for sensitive detection

    • Develop fluorescence-based or FRET-based assays for high-throughput applications

    • Consider coupled enzyme assays monitoring UDP release

Challenge 5: Mutagenesis Interpretation

  • Problem: Distinguishing between mutations affecting catalysis versus complex assembly.

  • Solutions:

    • Combine activity assays with interaction studies (co-IP, FRET, crosslinking)

    • Perform careful domain mapping of functional regions

    • Correlate mutations with resistance patterns to inhibitors like jawsamycin

How should researchers interpret conflicting data regarding SPT14/GPI3 function in different experimental contexts?

When confronted with conflicting data on SPT14/GPI3 function, researchers should systematically analyze potential sources of discrepancy:

Strain Background Variation:
Different S. cerevisiae strain backgrounds can significantly influence SPT14/GPI3 phenotypes. For example, laboratory strains may show different GPI synthesis profiles compared to clinical or environmental isolates. Always report precise strain information and consider validating key findings in multiple genetic backgrounds.

Growth Condition Dependencies:
SPT14/GPI3 phenotypes are highly dependent on growth conditions:

  • Medium composition (particularly carbon source)

  • pH conditions

  • Temperature

  • Growth phase

  • Oxygen availability

For example, yapsins associated with GPI anchoring function optimally at pH 5-6, similar to human colon conditions . Experiments conducted at standard laboratory pH may yield different results than those more closely mimicking in vivo conditions.

Assay Methodology Differences:
Different approaches to measuring SPT14/GPI3 function can yield apparently conflicting results:

  • In vitro biochemical assays vs. in vivo phenotypic assays

  • Different detection methods for GPI-anchored proteins

  • Varied approaches to measuring enzyme activity

Analytical Framework:

Conflict SourceInvestigation ApproachResolution Strategy
Strain differencesTest identical mutations in multiple backgroundsReport strain-specific effects
Growth conditionsSystematically vary key parametersDefine condition-dependent behavior
Assay methodologyCompare multiple assay typesDevelop integrated model explaining differences
Protein interactionsMap interaction partners in different contextsDefine context-dependent complex formation

Data Integration Recommendations:

  • Establish clear experimental frameworks stating all variables

  • Distinguish between direct and indirect effects of SPT14/GPI3 perturbation

  • Consider temporal aspects of GPI synthesis and turnover

  • Integrate genetic, biochemical, and physiological data into comprehensive models

  • Use mathematical modeling to reconcile apparently conflicting observations

By systematically addressing these considerations, researchers can resolve apparent contradictions and develop more nuanced models of SPT14/GPI3 function across diverse experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.