Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI15 (GPI15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
GPI15; YNL038W; N2687; Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI15; GPI-GlcNAc transferase complex subunit GPI5; GPI-GnT subunit GPI5; PIGH homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
GPI15
Target Protein Sequence
MISKEYEFGKTSILNRKKYTLVIDEDKNGNFIRFTVLPVSNRKFKKVKQNGRVEINMGIQ YHQIVLILLLNILFYVICLRSRFLEHINRTFEVTIARSFQILIIMGLFALGTIILVRGPS VETVTIFKESGLQLSRVKGMVIFPQQWNRKFFEQVEFISNERIIDVVINEGFCRGFRVIF YLAAIVRKSSTLKLLFPSNLPSIDDQRLIYNISRKYLSKQEKPLSRPKD
Uniprot No.

Target Background

Function

This protein is a component of the complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol. This is the initial step in GPI biosynthesis.

Database Links

KEGG: sce:YNL038W

STRING: 4932.YNL038W

Protein Families
PIGH family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is GPI15 and what role does it play in the GPI anchor biosynthesis pathway?

GPI15 is a subunit of the GPI-N-acetylglucosaminyltransferase (GPI-GnT) complex that initiates the first step in GPI anchor biosynthesis. In Saccharomyces cerevisiae, this multi-subunit enzyme complex comprises six subunits: Gpi1, Gpi2, Gpi3, Gpi15, Gpi19, and Eri1 . GPI15 functions within this complex to catalyze the transfer of N-acetylglucosamine from UDP-GlcNAc to phosphatidylinositol, forming GlcNAc-PI, which is the first intermediate in the GPI biosynthetic pathway .

The GPI anchor biosynthesis pathway is sequential and conserved across eukaryotes, generating a glycolipid anchor that serves to attach proteins to the cell membrane . This pathway is particularly important in fungi, where GPI-anchored proteins contribute significantly to cell wall integrity, morphogenesis, and virulence in pathogenic species .

How is GPI15 functionally characterized across different fungal species?

Functional characterization of GPI15 homologs has been performed in several fungal species:

SpeciesFunctional CharacteristicsExperimental ApproachesReference
Saccharomyces cerevisiaeCore component of GPI-GnT complex; essential for viabilityGene disruption studies; complementation assays
Candida albicansMaster activator of CaGPI2 and CaGPI19; regulates azole sensitivity and hyphal morphogenesisMutant studies; gene expression analysis; functional complementation
Leptosphaeria maculansRequired for morphogenesis, cell wall integrity, and pathogenicityRandom insertional mutagenesis; microscopic analyses; complementation experiments

In Candida albicans, CaGpi15 has been demonstrated to be functionally homologous to S. cerevisiae Gpi15 through complementation studies. CaGPI15 functions as a master transcriptional activator of other GPI-GnT subunits, specifically CaGPI2 and CaGPI19 . This regulatory role appears to be unique to C. albicans and different from what is observed in S. cerevisiae .

What phenotypic effects are observed when GPI15 is disrupted?

Disruption of GPI15 leads to several distinct phenotypic effects, which vary somewhat between fungal species:

In Leptosphaeria maculans, a plant pathogen, disruption of Lmgpi15 results in:

  • Blocked invasive growth phase during infection, despite unaffected initial penetration stages

  • Reduced growth rate in vitro

  • Aberrant hyphal morphology

  • Altered cell wall composition and integrity

In Candida albicans, CaGPI15 mutants display:

  • Increased sensitivity to azole antifungal drugs

  • Hypofilamentous growth (reduced hyphal formation)

  • Increased susceptibility to killing by macrophages and epithelial cells

  • Reduced ability to damage host cells

  • Attenuated virulence

These phenotypic effects demonstrate the critical importance of GPI15 for normal fungal growth, morphogenesis, cell wall integrity, and pathogenicity.

What methods are commonly used to study GPI15 function?

Several experimental approaches are employed to investigate GPI15 function:

  • Genetic Manipulation Techniques:

    • Gene disruption or deletion

    • Random insertional mutagenesis

    • RNA interference or gene silencing

    • Construction of conditional mutants

  • Functional Complementation:

    • Cross-species complementation to determine functional homology

    • Domain swapping to identify functional regions

  • Protein Localization:

    • GFP fusion proteins to determine subcellular localization

    • In the case of L. maculans, a functional translational fusion with GFP confirmed localization to the endoplasmic reticulum

  • Phenotypic Characterization:

    • Growth assays under various conditions

    • Cell wall integrity tests (e.g., sensitivity to cell wall-disrupting agents)

    • Microscopic analyses of morphology

    • Pathogenicity assays in appropriate host models

  • Biochemical Approaches:

    • Analysis of GPI anchor composition

    • Enzyme activity assays

    • Protein-protein interaction studies

How does the transcriptional cross-talk between GPI15 and other GPI-GnT subunits differ between fungal species?

The regulatory relationships between GPI15 and other GPI-GnT subunits exhibit significant species-specific differences, particularly between Candida albicans and Saccharomyces cerevisiae:

In Candida albicans:

  • CaGPI15 functions as a master transcriptional activator of both CaGPI2 and CaGPI19

  • CaGPI15 and CaERI1 are mutual activators of one another

  • CaGPI2 and CaGPI19 can independently activate CaGPI15, forming a feedback loop

  • CaGPI2 and CaGPI19 exhibit mutual negative regulation

In Saccharomyces cerevisiae:

  • No similar transcriptional cross-talk has been reported between GPI15 and other GPI-GnT components

  • The regulatory mechanisms appear to be distinct from those observed in C. albicans

Regulatory RelationshipCandida albicansSaccharomyces cerevisiae
GPI15 regulation of GPI2/GPI19Master activator of bothNo reported transcriptional regulation
GPI2 and GPI19 interactionMutually repressiveNo reported mutual regulation
GPI15 and ERI1 interactionMutual activatorsNo reported interaction
Feedback regulationGPI2 and GPI19 activate GPI15Not reported

This species-specific transcriptional cross-talk presents a complex regulatory network in C. albicans that is absent in S. cerevisiae, suggesting evolutionary divergence in the control of this essential pathway .

What is the molecular mechanism by which GPI15 influences azole sensitivity in Candida albicans?

The influence of GPI15 on azole sensitivity in C. albicans involves a complex regulatory network:

  • Transcriptional Co-regulation:

    • CaGPI15 activates CaGPI19 expression

    • CaGPI19 co-regulates CaERG11, which encodes the target of azole antifungal drugs

    • Consequently, CaGPI15 mutants exhibit reduced CaERG11 expression, leading to increased azole sensitivity

  • Epigenetic Regulation:

    • One mode of regulation occurs via histone H3 acetylation of the respective GPI-GnT gene promoters by the histone acetyltransferase Rtt109

    • Azole sensitivity of GPI-GnT mutants is partially attributed to decreased H3 acetylation at the CaERG11 promoter by Rtt109

  • Hierarchical Regulation:

    • CaGPI2 and CaGPI19 function downstream of CaGPI15

    • Altering CaGPI19 expression in a CaGPI15 mutant can modulate azole sensitivity via changes in CaERG11 expression

This regulatory cascade demonstrates how disruption of GPI15 can have pleiotropic effects, extending beyond its direct role in GPI anchor biosynthesis to influence drug sensitivity through altered gene expression patterns.

How can researchers design experiments to distinguish the enzymatic and regulatory functions of GPI15?

To differentiate between the enzymatic role of GPI15 in GPI anchor biosynthesis and its regulatory functions, researchers can implement the following experimental designs:

  • Domain-Specific Mutagenesis:

    • Create targeted mutations in different domains of GPI15

    • Assess which mutations specifically affect enzymatic activity versus regulatory functions

    • Test complementation of different phenotypes with domain mutants

  • Separation of Function Assays:

    • Develop systems to measure GPI anchor synthesis independent of transcriptional effects

    • For instance, use in vitro reconstitution of the GPI-GnT complex with purified components

    • Compare enzymatic activity measurements with gene expression analyses

  • Temporal Regulation Studies:

    • Implement time-course experiments using conditional GPI15 mutants

    • Determine whether enzymatic defects precede regulatory effects or vice versa

    • Use rapid protein degradation systems to acutely deplete GPI15 and monitor immediate versus delayed consequences

  • Cross-Species Hybrid Proteins:

    • Create chimeric proteins combining domains from species with different regulatory networks (e.g., S. cerevisiae and C. albicans)

    • Test whether the enzymatic function is preserved while regulatory functions are altered

    • This approach can help identify species-specific regulatory domains

  • Synthetic Genetic Array Analysis:

    • Perform large-scale genetic interaction screens with GPI15 mutants

    • Identify suppressors that rescue either enzymatic or regulatory phenotypes but not both

    • These distinct genetic interactors can help separate the dual functions

This multi-faceted experimental approach would help resolve the complex relationship between GPI15's direct role in GPI anchor biosynthesis and its broader regulatory functions in gene expression and cellular physiology.

What is the relationship between GPI15 function and fungal pathogenicity?

GPI15 contributes to fungal pathogenicity through multiple mechanisms:

  • Cell Wall Integrity and Composition:

    • GPI15 is essential for proper GPI anchor biosynthesis, which affects the incorporation of GPI-anchored proteins into the cell wall

    • In L. maculans, disruption of Lmgpi15 results in altered cell wall composition, which compromises invasive growth during plant infection

    • The cell wall integrity is critical for withstanding host defense mechanisms

  • Morphogenesis and Tissue Invasion:

    • In C. albicans, CaGPI15 mutants are hypofilamentous, showing reduced hyphal formation

    • This impairs the ability of the fungus to invade host tissues, as hyphal morphogenesis is a key virulence trait

  • Host-Pathogen Interactions:

    • CaGPI15 mutants show increased susceptibility to killing by macrophages and epithelial cells

    • They also demonstrate reduced ability to damage host cell lines compared to wild-type strains

  • Stress Adaptation:

    • Proper GPI15 function contributes to stress resistance, including adaptation to the host environment

    • This includes resistance to antifungal compounds, oxidative stress, and other host-derived stressors

Experimental data from C. albicans studies demonstrate the attenuated virulence of GPI15 mutants:

Host Cell TypeWild-type C. albicansCaGPI15 Mutant
MacrophagesNormal resistance to killingIncreased susceptibility to killing
Epithelial cellsEfficient damageReduced ability to cause damage
Host tissue invasionEffective hyphal penetrationImpaired invasive growth

These findings collectively indicate that GPI15 function is required for full virulence in pathogenic fungi, making it a potential target for antifungal drug development .

How can structural biology approaches contribute to understanding GPI15 function within the GPI-GnT complex?

Structural biology approaches offer powerful tools to elucidate GPI15's role within the multi-subunit GPI-GnT complex:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Can resolve the structure of the entire GPI-GnT complex

    • Reveals spatial relationships between GPI15 and other subunits (Gpi1, Gpi2, Gpi3, Gpi19, and Eri1)

    • Identifies interaction interfaces and potential allosteric regulation sites

  • X-ray Crystallography:

    • While challenging for membrane protein complexes, could resolve high-resolution structures of soluble domains

    • May identify catalytic residues and substrate binding regions

    • Useful for comparing orthologous proteins from different species

  • NMR Spectroscopy:

    • Can examine dynamics of individual domains and their interactions with substrates

    • Particularly valuable for studying flexible regions that may be involved in regulation

  • Cross-linking Mass Spectrometry:

    • Identifies specific residues involved in protein-protein interactions within the complex

    • Helps map the topology of GPI15 relative to other GPI-GnT subunits

  • Computational Structural Biology:

    • Homology modeling and molecular dynamics simulations can predict structural features

    • These approaches are particularly valuable given the limited structural data available

    • Can generate testable hypotheses about functional residues

The structural insights gained would address several key questions:

  • How does GPI15 contribute to the catalytic activity of the GPI-GnT complex?

  • What structural features account for the species-specific differences in regulatory networks?

  • Are there specific domains responsible for protein-protein interactions versus enzymatic function?

  • How does the structure inform potential inhibitor design for antifungal development?

These approaches would significantly advance our understanding of GPI15's dual roles in catalysis and regulation.

What are the optimal expression systems for producing recombinant GPI15 for structural and functional studies?

The choice of expression system for recombinant GPI15 must account for several challenges related to its membrane protein nature and functional requirements:

  • Yeast Expression Systems:

    • Advantages: Native post-translational modifications, correct membrane insertion, functional co-factors

    • Implementation: Use S. cerevisiae with strong inducible promoters (GAL1, CUP1)

    • Considerations: Include epitope tags (His, FLAG) for purification while confirming these don't disrupt function

    • Validation: Functional complementation of GPI15 deletion mutants confirms proper folding

  • Insect Cell Expression:

    • Advantages: Higher protein yields than yeast, eukaryotic processing

    • Implementation: Baculovirus expression vector systems with optimized secretion signals

    • Considerations: May require co-expression of other GPI-GnT subunits for stability

  • Mammalian Cell Expression:

    • Advantages: Most sophisticated post-translational modifications

    • Implementation: Transient or stable expression in HEK293 or CHO cells

    • Considerations: Lower yields but potentially better folding for structural studies

  • Cell-Free Systems:

    • Advantages: Rapid production, direct incorporation of modified amino acids

    • Implementation: Wheat germ or insect cell extracts with added microsomes

    • Considerations: Limited post-translational modifications

  • Bacterial Expression (for soluble domains):

    • Advantages: High yield, ease of isotopic labeling for NMR

    • Implementation: Express individual domains rather than full-length protein

    • Considerations: Lack of eukaryotic processing may affect folding

Expression SystemRecommended ApplicationKey Considerations
S. cerevisiaeFunctional studies, protein-protein interactionsLower yield but native environment
Insect cellsStructural biology, high-yield preparationsBalance between yield and proper folding
Mammalian cellsStudies requiring authentic glycosylationHighest authenticity but lowest yield
Cell-freeRapid screening of variantsLimited post-translational modifications
BacterialNMR studies of individual domainsOnly suitable for soluble domains

For optimal results, researchers should establish functional assays to verify that recombinant GPI15 retains its native properties regardless of the expression system chosen.

What approaches can resolve contradictions in the literature regarding GPI15 function?

Several contradictions exist in the literature regarding GPI15 function, particularly between different fungal species. The following approaches can help resolve these discrepancies:

  • Standardized Experimental Conditions:

    • Develop consensus protocols for studying GPI15 across different laboratories

    • Control for strain background effects that may influence phenotypic outcomes

    • Use identical growth conditions and media compositions to minimize variability

  • Comparative Genomics and Proteomics:

    • Perform systematic comparison of GPI15 orthologs across fungal species

    • Identify conserved versus species-specific domains that may explain functional differences

    • Correlate sequence variations with observed functional differences

  • Cross-Species Functional Studies:

    • Conduct heterologous expression experiments (expressing GPI15 from one species in another)

    • Assess whether functional differences are intrinsic to the protein or due to cellular context

    • Create chimeric proteins to map species-specific functional domains

  • Systems Biology Approaches:

    • Perform integrated transcriptomic, proteomic, and metabolomic analyses

    • Map the complete GPI15 interaction network in different species

    • Identify context-dependent factors that influence GPI15 function

  • Collaborative Multi-Laboratory Studies:

    • Organize consortium-based research involving multiple research groups

    • Perform identical experiments across different laboratories to ensure reproducibility

    • Establish repositories of standardized strains and reagents

For example, to resolve contradictions regarding the regulatory role of GPI15:

ContradictionExperimental ApproachExpected Outcome
Different transcriptional networks between C. albicans and S. cerevisiaeChIP-seq analysis of GPI15 binding sites in both speciesIdentification of species-specific regulatory targets
Variable phenotypic effects of GPI15 disruptionConstruction of identical mutations across species; phenotypic characterization under identical conditionsClarification of intrinsic versus context-dependent effects
Disparate biochemical functionsIn vitro reconstitution of GPI-GnT complexes from different speciesDirect comparison of enzymatic properties

These approaches would help distinguish genuine species-specific differences from experimental artifacts or incomplete characterization.

How might GPI15 be exploited as a target for novel antifungal development?

GPI15 presents several promising characteristics as a potential antifungal drug target:

  • Essential Pathway Targeting:

    • GPI anchoring is essential for fungal viability and virulence

    • Disruption of GPI15 impairs pathogenicity in multiple fungal species

    • Targeting an essential pathway may reduce the emergence of resistance

  • Potential for Selective Toxicity:

    • While GPI anchoring is conserved across eukaryotes, there are significant differences between fungal and mammalian GPI biosynthesis

    • These differences could be exploited to design selective inhibitors

    • The unique regulatory network in pathogenic fungi like C. albicans provides additional targets

  • Drug Development Strategies:

    • Structure-based drug design targeting GPI15 active site or protein-protein interactions

    • Allosteric inhibitors disrupting the assembly of the GPI-GnT complex

    • Small molecule modulators of the transcriptional regulatory network specific to pathogenic fungi

  • Potential Combination Therapies:

    • GPI15 inhibitors could be used in combination with existing antifungals

    • CaGPI15 mutants show increased sensitivity to azoles, suggesting synergistic potential

    • Multi-target approach may reduce the development of resistance

  • Screening Approaches:

    • Yeast-based high-throughput screens for compounds that phenocopy GPI15 disruption

    • In vitro enzymatic assays using reconstituted GPI-GnT complex

    • Structure-guided virtual screening using computational models

The development of GPI15 inhibitors would represent a novel class of antifungals with a mechanism distinct from current clinical options, potentially addressing the growing problem of antifungal resistance.

What technologies are needed to better understand the dynamics of the GPI-GnT complex in living cells?

Advanced technologies are required to fully elucidate the dynamics and regulation of the GPI-GnT complex in living cells:

  • Super-Resolution Microscopy:

    • Techniques such as STORM, PALM, or STED can resolve structures below the diffraction limit

    • Could visualize the assembly and localization of GPI-GnT complexes within the ER membrane

    • Multi-color imaging to track multiple subunits simultaneously

  • Live-Cell Single-Molecule Tracking:

    • Visualize the movement and interaction of individual GPI15 molecules

    • Determine residency times within the complex and exchange dynamics

    • Identify potential regulatory interactions that may be transient

  • FRET/BRET Biosensors:

    • Design sensors to monitor conformational changes in GPI15 during catalysis

    • Detect protein-protein interactions between GPI-GnT subunits in real-time

    • Assess how these interactions change under different cellular conditions

  • Proximity Labeling Proteomics:

    • Techniques like BioID or APEX2 fused to GPI15 can identify proximal proteins

    • Map the complete interaction network in different cellular states

    • Discover previously unknown regulatory partners

  • Cryo-Electron Tomography:

    • Visualize the GPI-GnT complex in its native membrane environment

    • Observe structural changes associated with different functional states

    • Integrate with subtomogram averaging for higher resolution

  • Single-Cell Transcriptomics and Proteomics:

    • Characterize cell-to-cell variability in GPI15 expression and function

    • Identify potential subpopulations with different GPI anchor biosynthesis activities

    • Correlate with phenotypic outcomes like drug resistance or morphogenesis

These technologies would provide unprecedented insights into how the GPI-GnT complex assembles, functions, and responds to cellular signals in living cells, advancing our understanding beyond what can be learned from biochemical or genetic approaches alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.