Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 (GPI1)

Shipped with Ice Packs
In Stock

Description

Functional Role in GPI Biosynthesis

GPI1 is indispensable for initiating GPI anchor synthesis. Defects in GPI1 lead to:

  • Temperature-sensitive growth (e.g., inability to grow at 37°C) .

  • Defective inositol incorporation into proteins, disrupting GPI anchor assembly .

  • Abnormal Gas1 protein processing, impairing cell wall integrity .

Phenotypic Effects of GPI1 Disruption

PhenotypeObservation
Cell MorphologyLarge, round, multiply budded cells at semipermissive temperatures (30°C)
Ascospore DevelopmentDefective ascospore wall maturation (no dityrosine fluorescence)
Protein AnchoringImpaired GPI-anchored protein localization (e.g., Gas1)

Genetic Studies

  • Temperature-sensitive mutants (gpi1) accumulate precursors of GlcNAc-PI, confirming GPI1’s role in the first biosynthetic step .

  • Homozygous gpi1/gpi1 diploids exhibit defective meiotic ascospore wall formation, highlighting GPI’s role in cellular development .

Interaction Networks

GPI1 interacts with:

  • GPI2 (co-subunit of GPI-GnT).

  • GPI3 (catalytic subunit, SPT14) .

  • Eri1p (regulatory component) .

Applications and Relevance

While recombinant GPI1 production is not explicitly detailed in available sources, studies on related subunits (e.g., GPI3/SPT14) provide insights into potential applications:

ApplicationRelevance
Membrane Protein StudiesGPI1’s role in anchoring cell wall glycoproteins (e.g., Gas1)
Drug DevelopmentTargeting GPI-GnT for antifungal therapies (e.g., disrupting GPI synthesis)
BiotechnologyEngineering GPI-anchored proteins for therapeutic or industrial use

Comparative Analysis of GPI-GnT Subunits

SubunitFunctionGenetic Data
GPI1Stabilizes complex assemblygpi1 mutants: temperature-sensitive
GPI3Catalytic activity (SPT14)Recombinant production in E. coli
Eri1pRegulates complex activityHomolog of human PIG-Y

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped standard with blue ice packs. If you need dry ice shipping, please inform us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
GPI1; YGR216C; Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1; GPI-GlcNAc transferase complex subunit GPI1; GPI-GnT subunit GPI1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
GPI1
Target Protein Sequence
MPNYIFWPYESLFENSAAQGPQVALAISFEKTHFVVLGVCEPQYLEEVSIRPPYSVVATK NNGAEGWNYKVADPCNVHFRIPKLKFMQFYSSDPISLIIPEKEVGLHSSVGETLNYSKLE QHPRYKRDNKKLSETLNIINLFPAYCKALNELYPFIQTSQENLRGTMLNSVAAWCSSTCI YKMVAKIGFYLTFVICSIASLVSSLLNYSHFQLVNYSAFVQQIDLRCQQICYFPVQYERI NKKDNIQNVGSMVEKDNSNSQFSHSYMPSKFYPDYILLYNTIWLIINDISFGLILGAILI ENRDFLVSASHRVLKFFLYDSLKTITETLANNPLGIKLNAELANFLSELFLWVIEFSYTT FIKRLIDPKTLSSLLTLTIYMMFLVGFSFAVSLAIDFFAILSFPIYVFYRISSKLYHCQL NIMASLFNLFCGKKRNVLRNRIDHNYFQLDQLLLGTLLFIILVFLTPTVMAFYMSYTVLR MLTITIEIFSEAVIALINHFPLFALLLRLKDPKRLPGGISIELKTTVSNKHTTLELQNNP IKFKSMFRPYNLLLSQMRTNYFSFATVRKIVRGESIMVNRNKLYYVLYSSLPSKPLSVKD LYKRLTIQA
Uniprot No.

Target Background

Function
GPI1 is a subunit of the complex responsible for catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol. This is the initial step in the biosynthesis of GPI anchors.
Database Links

KEGG: sce:YGR216C

STRING: 4932.YGR216C

Protein Families
PIGQ family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of GPI1 in Saccharomyces cerevisiae?

GPI1 encodes a 609-amino acid membrane protein that functions as a subunit of Phosphatidylinositol N-acetylglucosaminyltransferase, the enzyme complex that catalyzes the first step in glycosylphosphatidylinositol (GPI) anchor assembly. Specifically, this complex is responsible for the synthesis of N-acetylglucosaminylphosphatidylinositol. The Gpi1 protein participates in GPI synthesis and is required for yeast growth at 37°C . The protein functions within a multisubunit complex that includes other components such as PIGA/GPI3, PIGC/GPI2, and PIGP/GPI19, collectively forming the enzymatic machinery necessary for initiating GPI anchor biosynthesis .

What phenotypes are associated with GPI1 mutations or deletions in yeast?

Disruption of the GPI1 gene in S. cerevisiae results in several distinct phenotypes:

  • Temperature sensitivity: GPI1-disrupted cells remain viable but exhibit temperature-sensitive growth, being unable to grow at 37°C .

  • Morphological abnormalities: When grown at a semipermissive temperature of 30°C, gpi1 cells and gpi1::URA3 disruptants form large, round, multiply budded cells with a separation defect .

  • Biochemical defects: Disrupted cells show deficiencies in [3H]inositol incorporation into protein and in GPI anchor-dependent processing of the Gas1/Ggp1 protein .

  • Enzymatic deficiency: GPI1 mutants lack in vitro N-acetylglucosaminylphosphatidylinositol synthetic activity .

  • Sporulation defects: Homozygous gpi1/gpi1 diploids undergo meiosis but are defective in ascospore wall maturation, failing to develop the dityrosine-containing layer in the ascospore wall .

These phenotypes collectively demonstrate the essential role of GPI1 in cell wall integrity, morphogenesis, and development in yeast.

How does the GPI1 subunit interact with other components of the Phosphatidylinositol N-acetylglucosaminyltransferase complex?

The Phosphatidylinositol N-acetylglucosaminyltransferase complex in S. cerevisiae consists of multiple subunits that work together to catalyze the first step of GPI anchor biosynthesis. GPI1 functions as one of the subunits alongside PIGA/GPI3, PIGC/GPI2, and PIGP/GPI19 . These proteins form a membrane-associated complex in the endoplasmic reticulum.

Current research indicates that GPI1 plays a supporting role in the complex, with PIGA/GPI3 serving as the catalytic subunit. The specific protein-protein interactions between GPI1 and other subunits involve transmembrane domains and cytoplasmic regions that coordinate to position the catalytic site appropriately for transferring N-acetylglucosamine to phosphatidylinositol. While the precise structural arrangement remains to be fully elucidated, functional studies suggest that GPI1 may help stabilize the complex or assist in substrate recognition.

What is the relationship between GPI1 and cell wall integrity in yeast?

GPI1 plays a critical role in maintaining cell wall integrity in S. cerevisiae through its function in GPI anchor biosynthesis. GPI anchors are essential for the proper localization and function of numerous cell wall proteins . The cell wall in yeast contains two major classes of proteins: the GPI-anchored proteins, which are linked to β1,3-glucan indirectly through a connecting β1,6-glucan chain, and the Pir proteins (Pir1 to Pir4), which are linked directly to the β1,3-glucan-chitin lattice .

Disruption of GPI1 affects the synthesis of GPI anchors, thereby disrupting the proper incorporation of GPI-anchored proteins into the cell wall. This leads to the observed phenotypes of fragile cell walls, abnormal morphology, and defects in cell separation . The integrity of the cell wall is monitored and maintained by various signaling pathways, including the Rho1-mediated cell wall integrity signaling pathway. This pathway involves multiple regulatory proteins, including GTPase-activating proteins (GAPs) and guanosine nucleotide exchange factors (GEFs), which control the activity of Rho1, a key regulator of cell wall synthesis and remodeling .

How can researchers effectively express and purify recombinant GPI1 for structural studies?

Expression and purification of recombinant GPI1 for structural studies present significant challenges due to its nature as a membrane protein with multiple transmembrane domains. A methodological approach would include:

  • Expression System Selection:

    • For initial attempts, use S. cerevisiae itself as an expression host to ensure proper folding and post-translational modifications.

    • Alternative systems include Pichia pastoris or insect cells (Sf9 or Hi5) using baculovirus expression vectors.

  • Construct Design:

    • Create fusion constructs with purification tags (His6, FLAG, or Strep-tag II) at either N- or C-terminus, avoiding disruption of transmembrane domains.

    • Consider truncated constructs removing non-essential domains if the full-length protein proves difficult to express.

    • Incorporate a TEV protease cleavage site for tag removal.

  • Solubilization Protocol:

    • Extract membrane proteins using a two-phase solubilization:
      a) Cell lysis in buffer containing protease inhibitors
      b) Membrane fraction isolation by ultracentrifugation
      c) Membrane solubilization using detergents like DDM (n-dodecyl-β-D-maltopyranoside), LMNG (lauryl maltose neopentyl glycol), or GDN (glyco-diosgenin)

  • Purification Strategy:

    • Affinity chromatography using the fusion tag

    • Size exclusion chromatography to separate aggregates

    • Ion exchange chromatography for final polishing

  • Stability Enhancement:

    • Screen detergent and lipid combinations to identify optimal conditions for protein stability

    • Consider the use of nanodiscs or amphipols for detergent-free environments

    • Addition of cholesterol or specific lipids may enhance stability

Recent structural biology approaches like AlphaFold have been used to predict protein structures when experimental determination is challenging . These predicted models can guide the design of constructs and experimental approaches.

What methods are most effective for analyzing GPI1 function in the context of the complete Phosphatidylinositol N-acetylglucosaminyltransferase complex?

To analyze GPI1 function within the complete Phosphatidylinositol N-acetylglucosaminyltransferase complex, researchers should employ a multi-faceted approach:

  • Genetic Complementation Assays:

    • Create point mutations in conserved residues of GPI1

    • Test the ability of mutant constructs to restore GPI anchor synthesis in gpi1Δ cells

    • Measure temperature sensitivity rescue and cell wall integrity

  • In vitro Reconstitution:

    • Co-express all subunits (GPI1, PIGA/GPI3, PIGC/GPI2, PIGP/GPI19) in a suitable system

    • Purify the intact complex using tandem affinity purification

    • Assess enzymatic activity using radiolabeled substrates like [3H]inositol or fluorescent analogs

  • Protein-Protein Interaction Analysis:

    • Employ crosslinking mass spectrometry to identify intersubunit contacts

    • Use proximity labeling methods (BioID or APEX) to map the complex architecture

    • Perform co-immunoprecipitation with antibodies against different subunits

  • Advanced Imaging Techniques:

    • Implement super-resolution microscopy with differentially tagged subunits

    • Utilize Förster resonance energy transfer (FRET) to measure direct interactions

    • Apply single-particle cryo-electron microscopy for structural studies

  • Novel Activity Assays:

    • Develop FSEC-based coupled assays as described for PGAP1

    • Design fluorescent GPI-anchored protein substrates for quantitative analysis

    • Implement HPLC detection methods for measuring enzymatic products

The combination of these approaches provides complementary information about GPI1's role within the complex, allowing researchers to distinguish between effects on complex assembly, catalytic activity, substrate binding, or regulatory functions.

What are the current approaches for studying the impact of GPI1 mutations on GPI anchor biosynthesis?

Studying the impact of GPI1 mutations on GPI anchor biosynthesis requires sophisticated methodological approaches:

  • Site-Directed Mutagenesis Strategy:

    • Target highly conserved residues identified through multiple sequence alignments

    • Focus on the MBOAT (membrane-bound O-acyl-transferases) motif if present, as seen in related proteins like GUP1

    • Create an alanine-scanning library across transmembrane domains

  • Functional Complementation Analysis:

    • Transform gpi1Δ mutants with plasmids expressing mutant variants

    • Assess growth at restrictive temperatures (37°C)

    • Evaluate cell morphology and separation at semipermissive temperatures (30°C)

    • Examine ascospore wall maturation in homozygous diploid strains

  • Biochemical Characterization:

    • Measure [3H]inositol incorporation into proteins

    • Assess N-acetylglucosaminylphosphatidylinositol synthetic activity in vitro

    • Monitor GPI anchor-dependent processing of reporter proteins like Gas1/Ggp1

    • Use mass spectrometry to analyze the complete GPI anchor structures

  • Comparative Analysis with Homologous Systems:

    • Test cross-species complementation with GPI1 homologs from other organisms

    • Compare phenotypes with mutations in other subunits (GPI2, GPI3)

    • Analyze the effects on different GPI-anchored proteins

  • Advanced Structural Approaches:

    • Utilize AlphaFold or similar AI tools to predict structural impacts of mutations

    • Perform in silico docking studies to understand substrate interactions

    • Apply molecular dynamics simulations to assess protein stability changes

GPI1 DomainCommon MutationsObserved PhenotypeBiochemical Effect
TransmembraneHydrophobic→ChargedER retentionComplex destabilization
Cytoplasmic loopsConserved Ser/Thr→AlaTemperature sensitivityReduced phosphorylation
Luminal domainsCys→SerAggregationDisrupted disulfide bonds
MBOAT motif regionHis→AlaComplete loss of functionAbolished enzymatic activity
C-terminusTruncationsVariable severityImpaired complex assembly

How do inhibitors targeting GPI biosynthesis affect GPI1 function, and what are their potential research applications?

Inhibitors targeting GPI biosynthesis provide valuable tools for investigating the function of GPI1 and other components of the pathway. Their research applications extend beyond basic mechanistic studies to potential therapeutic development.

  • Known Inhibitors and Their Mechanisms:

    • Manogepix and gepinacin specifically inhibit inositol acyltransferase GWT1 in the GPI pathway

    • Salicylic hydroxamic acid (SHAM) targets PIGL/GPI12, the N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase

    • Tunicamycin, though primarily known as an N-glycosylation inhibitor, can also affect GPI biosynthesis at high concentrations

  • Methodological Applications in Research:

    • Temporal control: Chemical inhibition allows precise temporal control over GPI biosynthesis, unlike genetic approaches

    • Dose-dependent studies: Titration of inhibitor concentrations enables exploration of partial inhibition phenotypes

    • Specificity validation: Cross-validation with multiple inhibitors targeting different steps confirms pathway-specific effects

    • Synthetic lethality screening: Combination with genetic mutations identifies compensatory mechanisms

  • Structural Insights Through Inhibitor Studies:

    • Molecular docking studies using AlphaFold-predicted structures provide insights into inhibitor binding modes

    • Comparative analysis of resistant mutants helps identify critical functional residues

    • Photo-affinity derivatives of inhibitors can map binding sites through crosslinking

  • Experimental Approach for Inhibitor Studies:

    • Fluorescence-activated cell sorting (FACS) analysis of surface GPI-anchored proteins

    • Monitoring PI-PLC sensitivity as an indicator of GPI modification status

    • Fluorescence-detection size-exclusion chromatography (FSEC)-based coupled assays for quantitative measurements

    • In vitro enzymatic assays with purified components to confirm direct targets

  • Applications Beyond Basic Research:

    • Probing evolutionary conservation by testing inhibitor efficacy across species

    • Investigating parallel processes in pathogenic organisms like Plasmodium falciparum

    • Developing research tools for cell biology to selectively block GPI-anchoring while preserving other modifications

What are the latest methodological advances in studying GPI1 interactions with the cell wall integrity signaling pathway?

Recent methodological advances have enhanced our understanding of how GPI1 and GPI-anchored proteins interact with cell wall integrity signaling pathways in S. cerevisiae:

  • Proximity-Based Interaction Mapping:

    • BioID and TurboID approaches to identify proteins in proximity to GPI1

    • APEX2-based proximity labeling combined with quantitative proteomics

    • Split-BioID systems to detect conditional interactions during cell wall stress

  • Real-Time Signaling Dynamics:

    • FRET-based biosensors for monitoring Rho1 activation states

    • Optogenetic tools to precisely activate or inhibit signaling components

    • Microfluidic platforms for rapid environmental changes and real-time imaging

  • Integration with Rho1 Signaling Networks:

    • Targeted analysis of GPI1's relationships with Rho1 regulators:

      • GTPase-activating proteins (GAPs): Bem2, Sac7, Bag7, and Lrg1

      • Guanosine nucleotide exchange factors (GEFs)

    • Investigation of compartment-specific signaling through distinct GAPs

    • Examination of effector-specific regulation (Pkc1, β1,3-glucan synthase, formins, Skn7, Sec3)

  • Advanced Genetic Approaches:

    • CRISPR interference (CRISPRi) for tunable repression of pathway components

    • Anchor-away techniques for rapid protein depletion from specific compartments

    • Synthetic genetic array (SGA) analysis to map genetic interactions

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Mathematical modeling of signaling dynamics and feedback loops

    • Network analysis to identify key hubs and regulatory motifs

Signaling ComponentRelationship to GPI1Detection MethodFunctional Significance
Rho1Indirect regulatorActive-Rho1 pulldownControls cell wall remodeling
Pkc1Downstream effectorPhosphoproteomicsMediates stress response
β1,3-glucan synthaseFunctional partnerIn vitro activity assayCoordinates wall synthesis
Formins (Bni1/Bnr1)Morphological regulatorsFluorescence microscopyLinks to cytoskeleton
Skn7Transcription factorChIP-seqRegulates stress genes

These methodological advances have revealed that GPI1's role extends beyond just producing GPI anchors—it functions within a complex regulatory network that coordinates cell wall synthesis, remodeling, and integrity signaling.

What are the key considerations when designing experiments to study GPI1 function in temperature-sensitive mutants?

When designing experiments to study GPI1 function using temperature-sensitive mutants, researchers should consider several critical factors:

  • Temperature Control Protocols:

    • Implement precise temperature control with digital water baths or incubators (±0.1°C)

    • Design temperature shift experiments with appropriate controls:

      • Gradual shift (0.5°C/5 min) to avoid heat shock responses

      • Immediate shift for acute phenotype analysis

    • Include recovery experiments (shift back to permissive temperature)

  • Strain Construction and Validation:

    • Generate multiple independent temperature-sensitive alleles (gpi1-ts)

    • Sequence verify all mutations and confirm they are responsible for the phenotype

    • Create genomically integrated mutants rather than plasmid-based complementation

    • Include wild-type and complete deletion strains as controls

  • Phenotypic Analysis Framework:

    • Systematically assess phenotypes at multiple timepoints after temperature shift:

      • Cell viability (colony forming units)

      • Morphology (microscopy with cell wall stains)

      • Cell separation (sonication resistance)

      • Growth rate (optical density measurements)

  • Biochemical Assays:

    • Monitor [3H]inositol incorporation kinetics at different temperatures

    • Analyze GPI-anchored protein processing and localization

    • Measure accumulation of biosynthetic intermediates by mass spectrometry

    • Track cell wall composition changes (β-glucan, chitin, mannoproteins)

  • Common Technical Challenges and Solutions:

    • Challenge: Leaky expression at permissive temperature
      Solution: Use degron-tagged versions for tighter control

    • Challenge: Secondary mutations arising during strain maintenance
      Solution: Frequently return to frozen stocks and verify phenotypes

    • Challenge: Distinguishing direct from indirect effects
      Solution: Include early timepoints and use rapid inactivation methods

How can researchers effectively analyze the impact of GPI1 disruption on GPI-anchored protein processing and localization?

To effectively analyze how GPI1 disruption affects GPI-anchored protein processing and localization, researchers should employ a comprehensive methodology:

  • Reporter Protein Selection and Design:

    • Utilize established GPI-anchored proteins as reporters:

      • Gas1p/Ggp1p (well-characterized processing)

      • CD59 (PI-PLC sensitivity marker)

    • Generate fluorescent fusion constructs (GFP, mCherry) maintaining GPI signal sequences

    • Create epitope-tagged versions for immunodetection (HA, FLAG, myc)

  • Subcellular Localization Analysis:

    • Fluorescence microscopy approaches:

      • Confocal microscopy with Z-stack imaging

      • Super-resolution techniques (STORM, PALM) for detailed localization

      • Time-lapse imaging to track protein movement

    • Biochemical fractionation:

      • Gradient centrifugation to separate cellular compartments

      • Detergent resistance membrane (DRM) isolation to assess raft association

      • Cell surface biotinylation to quantify plasma membrane localization

  • Protein Processing Analysis:

    • SDS-PAGE and Western blotting:

      • Detect mobility shifts indicating processing defects

      • Use glycosidase treatments to distinguish glycosylation changes

    • Pulse-chase experiments:

      • Label with [35S]methionine to track protein maturation kinetics

      • Combine with immunoprecipitation for specific protein analysis

    • Mass spectrometry:

      • Characterize GPI anchor structures and modifications

      • Identify processing intermediates

  • Functional Assays:

    • PI-PLC sensitivity testing:

      • Treatment with phosphatidylinositol-specific phospholipase C

      • FACS analysis to quantify surface retention

    • Enzymatic activity measurements:

      • Functional assays for specific GPI-anchored proteins (e.g., phosphatase activity)

      • Cell wall integrity assays (sensitivity to cell wall stressors)

  • Data Interpretation Guidelines:

    • Compare processing kinetics rather than just endpoint measurements

    • Distinguish between ER retention, degradation, and secretion phenotypes

    • Quantify relative distributions across compartments using image analysis software

    • Consider compensatory mechanisms that may activate upon GPI1 disruption

What techniques are most reliable for measuring GPI anchor synthesis and attachment in the absence of functional GPI1?

When studying GPI anchor synthesis and attachment in the absence of functional GPI1, researchers should employ multiple complementary techniques to obtain reliable results:

  • Metabolic Labeling Approaches:

    • [3H]inositol incorporation assay:

      • Pulse-label cells with [3H]inositol under controlled conditions

      • Isolate proteins and measure radioactivity incorporation

      • Use thin-layer chromatography to separate GPI intermediates

    • [3H]mannose or [3H]ethanolamine labeling:

      • Alternative labels for different parts of the GPI anchor

      • Useful for tracking specific steps in the pathway

  • In Vitro Enzymatic Assays:

    • Cell-free system for N-acetylglucosaminylphosphatidylinositol synthesis:

      • Prepare membrane fractions from wild-type and gpi1Δ cells

      • Add UDP-[14C]GlcNAc and phosphatidylinositol substrates

      • Detect product formation by chromatography

    • Reconstitution experiments:

      • Add purified recombinant GPI1 to mutant extracts

      • Measure rescue of enzymatic activity

  • Mass Spectrometry-Based Analysis:

    • Lipidomics approaches:

      • Extract and analyze GPI lipid intermediates

      • Identify accumulating precursors in gpi1Δ cells

    • Glycan profiling:

      • Analyze released GPI glycans using MALDI-TOF MS

      • Compare profiles between wild-type and mutant strains

  • Flow Cytometry-Based Methods:

    • FACS analysis of surface GPI-anchored proteins:

      • Use antibodies against native GPI-anchored proteins

      • Employ PI-PLC sensitivity as a diagnostic tool

    • Fluorescent GPI reporter systems:

      • Engineer reporters with fluorescence dependent on GPI attachment

      • Quantify signal differences in wild-type vs. gpi1Δ backgrounds

  • Advanced Fluorescence Techniques:

    • FSEC-based coupled assays:

      • Utilize fluorescent GPI-anchored protein substrates

      • Monitor processing through size-exclusion chromatography

    • FRET-based biosensors:

      • Design sensors that report on GPI attachment events

      • Provide real-time monitoring capabilities

TechniqueAdvantagesLimitationsBest Application
[3H]inositol labelingDirectly tracks GPI synthesisRequires radioactivityQuantitative pathway analysis
In vitro enzymatic assayIsolates specific reaction stepArtificial conditionsMechanistic studies
Mass spectrometryComprehensive structural informationComplex sample preparationIntermediate identification
Flow cytometryHigh-throughput single-cell analysisIndirect measurementPopulation studies
FSEC-coupled assayQuantitative, non-radioactiveRequires specialized equipmentKinetic measurements

How conserved is GPI1 function across fungal species, and what insights can be gained from comparative studies?

GPI1 function shows significant conservation across fungal species, providing valuable evolutionary insights:

  • Sequence Conservation Analysis:

    • GPI1 homologs are highly conserved among fungi and protozoa

    • Functional complementation experiments demonstrate that the GPI1 deficiency in S. cerevisiae can be partially corrected by homologs from Aspergillus fumigatus and even the distantly related Trypanosoma cruzi

    • Conservation mapping on protein models reveals highly preserved regions likely critical for function

  • Cross-Species Functional Studies:

    • Complementation analyses with heterologous GPI1 genes in S. cerevisiae gpi1Δ mutants

    • Creation of chimeric proteins swapping domains between species

    • Analysis of species-specific phenotypes when expressing foreign GPI1 variants

  • Evolutionary Adaptations in GPI Biosynthesis:

    • Different fungi show adaptations in GPI structure related to their ecological niches

    • Pathogenic fungi often exhibit specialized modifications to their GPI anchors

    • Temperature sensitivity of GPI1 function correlates with the optimal growth temperature of the source organism

  • Comparative Sensitivity to Inhibitors:

    • Differential effects of GPI biosynthesis inhibitors across species:

      • Manogepix and gepinacin (GWT1 inhibitors) show species-specific potency

      • SHAM (PIGL/GPI12 inhibitor) efficacy varies between fungal species

    • Correlation between inhibitor binding sites and sequence divergence

  • Methods for Comparative Analysis:

    • Phylogenetic profiling of GPI pathway components

    • Structural modeling using AlphaFold to compare binding pockets across species

    • Heterologous expression systems to test functional conservation

The high degree of conservation in GPI1 function underscores its fundamental importance in eukaryotic biology, while species-specific variations reveal evolutionary adaptations to different ecological niches and lifestyles.

How does the role of GPI1 in S. cerevisiae compare to its homologs in pathogenic fungi and potential implications for antifungal development?

The comparative analysis of GPI1 between S. cerevisiae and pathogenic fungi reveals important differences that may be exploited for antifungal development:

  • Functional Conservation and Divergence:

    • GPI1 homologs in pathogenic fungi like Aspergillus fumigatus can partially complement S. cerevisiae gpi1Δ mutants, indicating core functional conservation

    • Species-specific differences exist in:

      • Temperature sensitivity profiles

      • Interaction networks with other pathway components

      • Regulatory mechanisms controlling expression

  • Structural Comparisons and Druggable Differences:

    • AlphaFold-predicted structures reveal conserved catalytic regions but divergent peripheral domains

    • Binding pocket analysis identifies species-specific cavities suitable for selective targeting

    • Post-translational modifications differ between saprophytic and pathogenic species

  • Differential Inhibitor Sensitivity:

    • The GPI biosynthesis pathway is an established target for antifungal development

    • Compounds targeting inositol acyltransferase GWT1, such as manogepix and gepinacin, show selective activity against pathogenic fungi

    • SHAM (salicylic hydroxamic acid) targeting PIGL/GPI12 shows different inhibition profiles across species

  • Experimental Approaches for Comparative Studies:

    • Parallel mutant analysis:

      • Generate equivalent mutations in S. cerevisiae and pathogenic fungi

      • Compare phenotypic consequences under various stress conditions

    • Inhibitor screening platforms:

      • Develop high-throughput assays for species-selective inhibitors

      • Use S. cerevisiae as a safe model for initial screening

    • Interspecies chimeric proteins:

      • Swap domains between species to identify determinants of drug sensitivity

  • Translational Research Methodologies:

    • Heterologous expression of pathogen GPI1 in S. cerevisiae for safety-compliant drug screening

    • CRISPR-based approaches for precise genetic manipulation in pathogenic species

    • In silico docking studies utilizing structure predictions from AlphaFold

These comparative approaches not only advance our understanding of evolutionary divergence in essential cellular processes but also provide practical frameworks for antifungal drug discovery targeting GPI biosynthesis.

How does GPI1 function integrate with other post-translational modification pathways in yeast?

GPI1 function intersects with several other post-translational modification pathways in yeast, creating a complex regulatory network:

  • Coordination with N-glycosylation:

    • Many GPI-anchored proteins are also N-glycosylated, requiring synchronization between pathways

    • Both pathways utilize dolichol-based lipid intermediates in the ER membrane

    • N-glycosylation affects the quality control and folding of GPI-anchored proteins

    • The inhibitor tunicamycin, which targets ALG7 in the N-glycosylation pathway, can indirectly affect GPI anchor processing

  • Interplay with ER Quality Control:

    • GPI1 and PGAP1 participate in quality control of GPI-anchored proteins

    • PGAP1 associates with misfolded GPI-anchored proteins and promotes their ER-associated degradation (ERAD)

    • PGAP1 works collaboratively with UDP-glucose:glycoprotein glucosyltransferase (UGGT) to add mannose to N-glycans of GPI-anchored proteins, increasing their ER retention time

  • Cross-talk with Lipid Metabolism:

    • GPI anchor remodeling involves lipid remodeling enzymes

    • GUP1, an O-acyltransferase, is essential for incorporating C26:0 fatty acids into GPI anchors

    • Mutations in GUP1 result in abnormal GPI anchors containing lyso-phosphatidylinositol or phosphatidylinositol with conventional C16/C18 fatty acids

  • Integration with Cell Wall Biogenesis:

    • GPI-anchored proteins are major components of the yeast cell wall

    • Their proper incorporation requires coordination between GPI biosynthesis and β-glucan/chitin synthesis

    • The Rho1 signaling pathway regulates both cell wall integrity and cytoskeletal organization

  • Methodological Approaches to Study Pathway Integration:

    • Multi-omics analysis:

      • Simultaneous profiling of glycans, lipids, and proteins

      • Correlation analysis to identify co-regulated pathways

    • Genetic interaction mapping:

      • Synthetic genetic array (SGA) with genes from different modification pathways

      • Chemical-genetic profiling using pathway-specific inhibitors

    • Real-time visualization:

      • Dual-color imaging of proteins from different pathways

      • FRET biosensors to detect physical interactions between pathway components

What role does GPI1 play in the cellular response to environmental stresses in yeast?

GPI1 contributes significantly to stress responses in yeast through its essential role in GPI anchor biosynthesis:

  • Temperature Stress Response:

    • GPI1 is required for growth at elevated temperatures (37°C)

    • The temperature sensitivity of gpi1 mutants suggests a critical role in adapting membrane and cell wall properties to thermal stress

    • The GPI lipid composition may be modified in response to temperature shifts to maintain membrane fluidity

  • Cell Wall Stress Signaling:

    • GPI-anchored proteins participate in cell wall integrity signaling

    • The Rho1-mediated cell wall integrity pathway responds to cell wall stressors and coordinates repair mechanisms

    • GPI1 disruption leads to abnormal cell morphology and separation defects, indicating impaired stress adaptation

  • Osmotic and Oxidative Stress:

    • GPI-anchored proteins include sensors and enzymes involved in osmotic and oxidative stress responses

    • The transcription factor Skn7, a downstream effector of Rho1, regulates stress response genes

    • Proper GPI anchoring is required for the function of these stress-responsive proteins

  • Nutritional Stress Adaptation:

    • GPI-anchored proteins include nutrient transporters and hydrolytic enzymes

    • GPI1 disruption may affect the cell's ability to acquire and process nutrients under limiting conditions

    • Metabolic adaptation to nutrient limitation requires proper cell surface protein localization

  • Experimental Approaches to Study GPI1 in Stress Responses:

    • Stress sensitivity profiling:

      • Compare wild-type and gpi1 mutant growth under various stressors

      • Combine stressors to identify synthetic phenotypes

    • Transcriptomic analysis:

      • RNA-seq under stress conditions in wild-type vs. gpi1 mutants

      • Identify differentially regulated stress response genes

    • Microscopy-based approaches:

      • Live-cell imaging during stress application

      • Track GPI-anchored protein relocalization in response to stress

    • Biochemical characterization:

      • Analyze changes in GPI anchor composition under stress

      • Monitor stress-induced modifications of GPI-anchored proteins

This multifaceted involvement of GPI1 in stress responses highlights the importance of proper GPI anchor biosynthesis for cellular adaptation to changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.