Recombinant Saccharomyces cerevisiae Plasma membrane-associated coenzyme Q6 reductase PGA3 (PGA3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PGA3; NQR1; YML125C; YM4987.10C; YM7056.01C; Plasma membrane-associated coenzyme Q6 reductase PGA3; Processing of GAS1 and ALP protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PGA3
Target Protein Sequence
MSKEDIEGTNILDEPVHGIYIPAALFVVGVAITTYMSGELKILWSLPILFMIIFVRAYSA YKRRRSLYPDRWTSLELEDQTIISKNTALYRFKLKTRLESLDIPAGHHVAVRVPIDGKQE VRYYNPISSKLESGYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGTLNYEPNSSKHL GIVAGGSGITPVLQILNEIITVPEDLTKVSLLYANETENDILLKDELDEMAEKYPHFQVH YVVHYPSDRWTGDVGYITKDQMNRYLPEYSEDNRLLICGPDGMNNLALQYAKELGWKVNS TRSSGDDQVFVF
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Plasma membrane-associated coenzyme Q6 reductase PGA3 (PGA3) is a NADH-dependent cytochrome b5 reductase. It reduces coenzyme Q6 at the plasma membrane and mediates lifespan extension via calorie restriction by shifting metabolism from fermentative to respiratory processes. This modulation likely occurs through alteration of the NAD+/NADH ratio.
Database Links

KEGG: sce:YML125C

STRING: 4932.YML125C

Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary biochemical role of PGA3 in Saccharomyces cerevisiae plasma membranes?

Methodological Answer:
PGA3 functions as a critical component of the plasma membrane electron transport system, primarily mediating NADH-driven reduction of coenzyme Q6 (CoQ6) to maintain extracellular ascorbate stabilization. This activity was confirmed through comparative studies using coq3Δ mutants (defective in CoQ6 biosynthesis) and wild-type strains. Researchers employ NADH-ascorbate free radical reductase assays with inhibitors like chloroquine/dicumarol to isolate PGA3-specific activity . For validation:

  • Measure CoQ6-dependent electron transfer using ferricyanide/cytochrome c as alternate acceptors

  • Compare activity in atp2Δ (respiration-deficient but Q6-competent) vs. coq3Δ mutants

  • Use detergent solubilization (Zwittergent 3-14) to confirm membrane association

How do researchers confirm CoQ6 dependence in PGA3-mediated redox systems?

Methodological Answer:
Genetic complementation and exogenous Q6 supplementation are key strategies:

  • Transform coq3Δ mutants with plasmid-borne COQ3 to rescue Q6 biosynthesis

  • Cultivate mutants in Q6-supplemented media and quantify membrane Q6 via HPLC-ECD

  • Compare redox activity recovery in mitochondria vs. plasma membrane fractions

Data Contradiction Analysis:
While Q6 restoration rescues ascorbate reductase activity in plasma membranes, mitochondrial Q6 uptake in EG103 strains remains impaired due to endocytic trafficking defects . This highlights compartment-specific Q6 trafficking mechanisms.

What experimental approaches resolve conflicting data on PGA3’s role in superoxide-dependent vs. independent pathways?

Methodological Answer:
Studies show PGA3 operates via two distinct mechanisms:

  • CoQ6-dependent pathway: Blocked by quinone antagonists (dicumarol) and absent in coq3Δ mutants

  • Iron-regulated pathway: Activated in low-iron conditions, independent of Q6 but requiring ferric reductase

Key experimental designs:

  • Use SOD (superoxide dismutase) to test superoxide involvement

  • Culture strains in iron-depleted media (+ bathophenanthroline) to induce ferric reductase activity

  • Quantify FM4-64 uptake defects in erg2/coq3Δ double mutants to link endocytosis to Q6 trafficking

How do researchers address challenges in detecting PGA3 activity in recombinant systems?

Methodological Answer:
Common pitfalls include improper membrane fractionation and interference from mitochondrial homologs. Solutions involve:

  • Differential centrifugation with sucrose gradients to isolate pure plasma membranes

  • Use atp2Δ or cor1Δ controls to exclude respiratory chain artifacts

  • Fluorescence quenching assays with resorufin-NADH to quantify redox coupling

Critical Data Table:

StrainCoQ6 (nmol/mg)NADH-AFR Activity (Units)SOD Sensitivity
Wild-type12.3 ± 0.845.2 ± 3.1No
coq3Δ0.04.7 ± 0.9No
coq3Δ + Q69.1 ± 1.238.6 ± 2.7No
atp2Δ11.8 ± 0.742.1 ± 2.9Yes
Data synthesized from

What genetic tools enable functional analysis of PGA3 in engineered yeast strains?

Methodological Answer:
Advanced CRISPR-Cas9 systems (e.g., pCEC-red) allow marker-free editing:

  • Design gRNAs targeting PGA3 loci using Golden Gate Assembly for high-efficiency cloning

  • Use homology-directed repair with Q6 biosynthetic genes (COQ3, COQ7) for pathway analysis

  • Validate edits via colony PCR and LC-MS quantification of Q6 species

Example Workflow:

  • Knock out PGA3 in erg2Δ background to disrupt endocytosis

  • Transform with plasmid overexpressing COQ3 under inducible promoter

  • Profile Q6 distribution in Golgi/vacuole fractions via subcellular fractionation

How do researchers reconcile discrepancies in PGU1 gene presence vs. PGA3 activity?

Methodological Answer:
Some S. cerevisiae strains retain PGU1 (polygalacturonase) homologs but lack PGA3 activity due to:

  • Non-functional promoter regions (test via RT-qPCR)

  • Post-translational modifications (assess via zymogram assays)

  • Epigenetic silencing (use chromatin immunoprecipitation for histone marks)

Contradiction Resolution:
Blanco et al. reported conserved PGU1 in all strains, but recent data show 28% of wine yeasts lack active PGA3 despite gene presence . This suggests strain-specific regulatory elements upstream of PGA3.

Technical Notes for Experimental Design

  • Critical Controls: Always include coq3Δ + vector control and atp2Δ (respiratory-deficient) strains to isolate plasma membrane-specific effects

  • Activity Assays: Use 100 μM NADH + 50 μM ascorbate free radical (pH 6.0) for optimal PGA3 activity measurement

  • Inhibitor Concentrations: 10 μM chloroquine (Q6 antagonist); 50 U/mL SOD (superoxide scavenger)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.