Recombinant Saccharomyces cerevisiae Plasma membrane iron permease (FTR1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Characterization

FTR1 is identified as the permease component of the Fet3p-Ftr1p high-affinity iron-uptake complex located in the plasma membrane of Saccharomyces cerevisiae. This protein specifically transports Fe3+ (ferric iron) produced by the Fet3p ferroxidase into the cell . Also known as high-affinity iron permease FTR1 or simply Ftr1p, this protein is encoded by the FTR1 gene and plays a direct role in iron transport across the cell membrane .

The protein has been thoroughly characterized through recombinant expression systems. Commercial preparations of recombinant FTR1 are typically produced with purity levels greater than or equal to 85% as determined by SDS-PAGE analysis . These recombinant forms serve as valuable tools for investigating the structure-function relationships of this critical iron transport protein.

Available Recombinant Forms

Various expression systems have been developed for the production of recombinant FTR1. These systems utilize different host organisms to produce the protein with specific characteristics tailored to various research applications. The diversity of available recombinant forms demonstrates the significant research interest in this protein.

Host SystemProduct NamePurityOther NamesSource
E. Coli/Yeast/Baculovirus/Mammalian CellRecombinant Saccharomyces cerevisiae Plasma membrane iron permease (FTR1)≥85% by SDS-PAGEPlasma membrane iron permease; Ftr1p
Cell Free ExpressionRecombinant Saccharomyces cerevisiae Plasma membrane iron permease (FTR1)≥85% by SDS-PAGEHigh-affinity iron permease FTR1
E. Coli/Yeast/Baculovirus/Mammalian CellRecombinant Saccharomyces cerevisiae Plasma membrane iron permease (FTR1), partial≥85% by SDS-PAGEHigh-affinity iron permease FTR1

Functional Motifs and Domains

Several sequence elements within FTR1 have been identified as critical for its iron uptake function. These conserved motifs represent essential structural components that directly participate in the mechanism of iron permeation across the membrane.

Two REXLE (Arg-Glu-Xaa-Leu-Glu) motifs located in transmembrane domains 1 and 4 are particularly significant. Experimental evidence has shown that alanine substitutions at any of the six arginine or glutamic acid residues within these motifs completely inactivate FTR1's iron uptake function, demonstrating that both motifs are essential to iron permeation . Additional studies with R→K and E→D substitutions resulted in variable loss of activity, suggesting that while all six residues are essential, their contributions to uptake are quantitatively and/or mechanistically distinct .

Other critical functional elements include:

  1. An EDLWE89 element associated with transmembrane domain 3, where the terminal glutamate (E89) is required for function. Mutation of this residue (E89A) reduces activity to only 20% of wild-type levels .

  2. A DASE motif located in extracellular loop 6, where double substitution to AASA completely inactivates FTR1 in iron uptake .

  3. Residue Ile369 in the cytoplasmic C-terminal domain, where deletion or substitution leads to a 70% loss of iron-uptake activity. This is the only residue identified in this domain that makes such a major contribution to iron uptake by the Fet3p-Ftr1p complex .

These motifs are strongly conserved among fungal FTR1 homologues, highlighting their evolutionary importance in iron transport mechanisms .

Functional Mechanisms and Interactions

FTR1 functions as part of a complex with Fet3p, a multicopper oxidase, to facilitate high-affinity iron uptake in yeast. This protein complex represents a sophisticated system for iron acquisition that operates efficiently even under iron-limited conditions.

The Fet3p-Ftr1p Complex

The interaction between FTR1 and FET3 demonstrates a remarkable interdependence that ensures proper assembly and function of the iron uptake system. Research has demonstrated that FET3 expression is required for FTR1 protein to be properly transported to the plasma membrane . Conversely, FTR1 expression is required for apo-FET3 protein to be loaded with copper and thus acquire its essential oxidase activity .

This mutual dependence creates a functional unit where Fet3p oxidizes Fe2+ to Fe3+, and then Ftr1p transports the resulting Fe3+ into the cell. This two-step process enables efficient iron acquisition while preventing the uptake of potentially harmful ferrous (Fe2+) iron that could generate reactive oxygen species inside the cell.

Role in Iron Transport

The mechanism of iron transport by FTR1 involves specific mutations in conserved sequence motifs that can block iron transport without affecting protein expression or localization. Experimental evidence has shown that mutations in the REXLE motifs specifically disrupt the iron transport function of the protein . This suggests that these motifs are directly involved in creating an iron-specific transport channel across the plasma membrane.

FTR1 as a Transceptor

Recent research has identified FTR1 as more than just a transporter - it also functions as a transceptor (transporter receptor) involved in signaling pathways. Specifically, FTR1 has been identified as an iron micronutrient transceptor for activation of the PKA (Protein Kinase A) pathway in Saccharomyces cerevisiae .

Transceptors represent an intriguing class of proteins that combine the functions of transporters and receptors, allowing cells to sense and respond to nutrient availability. The dual function of FTR1 as both a high-affinity iron transporter and a signaling component highlights its sophisticated role in coordinating cellular responses to iron availability.

Applications in Research and Biotechnology

The recombinant production of FTR1 has enabled various research applications, from basic studies of iron metabolism to exploration of therapeutic targets.

Research on Iron Metabolism

Recombinant FTR1 has been instrumental in elucidating the mechanisms of high-affinity iron uptake in fungi. The availability of purified protein has allowed researchers to conduct detailed structure-function studies, identifying key residues and motifs essential for iron transport . These findings contribute to our understanding of how eukaryotic cells acquire iron, an essential but potentially toxic micronutrient.

Potential Therapeutic Applications

FTR1 has emerged as a potential target for antifungal therapies. Research on FTR1 proteins from pathogenic fungi has focused on epitope mapping to identify potential targets for therapeutic intervention . The ElliPro prediction server has been used to identify antigenic residues from 3D models of FTR1 protein to predict the conformation of B-cell epitopes that could be targeted by antifungal agents or vaccines .

Table 1 below shows potential B-cell epitopes identified from FTR1 protein, highlighting regions that could be targeted for therapeutic development:

No.Number of residuesScoreFunction
147 residues including A:F304, A:F307, A:K310, and others0.765Potential B-cell epitope for targeting pathogenic fungi
237 residues including A:F36, A:N37, A:T38, and others0.735Potential B-cell epitope for targeting pathogenic fungi
365 residues including A:A66, A:A67, A:I69, and others0.732Potential B-cell epitope for targeting pathogenic fungi
419 residues including A:M1, A:S2, A:Q3, and others0.724Potential B-cell epitope for targeting pathogenic fungi
53 residues: A:F59, A:L62, A:C630.61Potential B-cell epitope for targeting pathogenic fungi

These epitopes represent regions of the FTR1 protein that could be targeted by antibodies or other therapeutic agents, potentially disrupting iron acquisition in pathogenic fungi while minimizing effects on human cells .

Recombinant Production Methods

The production of recombinant FTR1 has been accomplished using various expression systems, each with advantages for different applications. These systems include E. coli, yeast, baculovirus, mammalian cell, and cell-free expression systems .

Expression Hosts and Purification

The choice of expression host can significantly impact the properties of the recombinant protein. E. coli systems offer high yield and cost-effectiveness but may struggle with proper folding of complex membrane proteins. Yeast expression systems provide a eukaryotic environment that may better support proper folding and post-translational modifications. Baculovirus and mammalian cell systems can produce proteins with more native-like modifications but at higher cost .

Regardless of the expression system, recombinant FTR1 is typically purified to at least 85% purity as determined by SDS-PAGE analysis . This level of purity is suitable for most research applications, including structural studies, functional assays, and antibody production.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please specify it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
FTR1; YER145C; Plasma membrane iron permease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FTR1
Target Protein Sequence
MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQVWVGVLLGFI ICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMISMMGIPMLRMNKMQSKWRVK IARSLVEIPHRKRDYFKIGFLSRRYAMFLLPFITVLREGLEAVVFVAGAGITTQGSHASA YPLPVVVGLICGGLVGYLLYYGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFN LASGGDASEGGDGNGSYNIRKAVYHVNCCNPELDNGWDIFNALLGWQNTGYLSSMLCYNI YWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTEEQKRQLFAKMEN INFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLHVKADSL
Uniprot No.

Target Background

Function
Permease responsible for high-affinity iron uptake.
Database Links

KEGG: sce:YER145C

STRING: 4932.YER145C

Protein Families
Oxidase-dependent Fe transporter (OFeT) (TC 9.A.10.1) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the FTR1 protein and what is its function in Saccharomyces cerevisiae?

FTR1 (Ferrous Transport Protein 1) is a high-affinity iron permease located in the plasma membrane of S. cerevisiae. It functions as a critical component of the reductive iron uptake system in fungi. This system contains redundant surface reductases that reduce ferric iron (Fe³⁺) into the more soluble ferrous form (Fe²⁺). The solubilized ferrous iron is then transported across the membrane by a protein complex consisting of a multicopper oxidase and the ferrous permease encoded by the FTR1 gene .

In iron-dependent environments, FTR1 is required for efficient iron transport across the plasma membrane. The protein is particularly important when environmental iron levels are low, allowing the organism to scavenge trace amounts of this essential micronutrient. Studies in various fungi have demonstrated that disruption of the FTR1 gene leads to reduced virulence in pathogenic species, indicating its importance for fungal survival and pathogenesis .

How does the FTR1 iron transport system differ between S. cerevisiae and pathogenic fungi?

While the fundamental mechanism of iron acquisition through the FTR1 system is conserved across many fungal species, there are notable differences between S. cerevisiae and pathogenic fungi. In S. cerevisiae, the FTR1 system primarily serves a metabolic function, ensuring adequate iron acquisition for cellular processes under varying environmental conditions.

In contrast, in pathogenic fungi such as Rhizopus and Mucor species, the FTR1 system has evolved as a key virulence factor. Research has demonstrated that FTR1 in these species is required for iron acquisition from host tissues during infection. Disruption of the FTR1 gene in these organisms results in significantly reduced virulence in animal models . This functional difference makes FTR1 an attractive target for antifungal vaccine development against pathogenic species while using the well-characterized S. cerevisiae system as a model for basic research.

What experimental systems are available for studying recombinant FTR1 expression in S. cerevisiae?

Several experimental systems are available for studying recombinant FTR1 expression in S. cerevisiae. One commonly used approach is the FLP/FRT recombination system. This system, native to S. cerevisiae, allows for precise genetic manipulation and marker recycling .

The FLP/FRT system consists of the FLP recombinase that catalyzes recombination between two FRT (FLP Recognition Target) sequences. For studying FTR1, researchers can design constructs where the FTR1 gene is flanked by FRT sequences, allowing for controlled expression and potential excision. The system can be modified to include selection markers (such as nourseothricin resistance) for identifying successful transformants .

When designing experiments for recombinant FTR1 expression, researchers should consider:

  • Promoter selection for appropriate expression levels

  • Addition of epitope tags for detection and purification

  • Inclusion of selectable markers for transformant selection

  • Codon optimization if expressing in heterologous systems

How can the FLP/FRT recombination system be optimized for FTR1 functional studies in S. cerevisiae?

For advanced functional studies of FTR1, optimizing the FLP/FRT recombination system provides significant advantages. Based on experimental findings with similar recombination systems, the following methodological approach is recommended:

First, construct an FRT-marker cassette where the FTR1 gene of interest is flanked by FRT sequences in direct repeat orientation. This cassette should include an appropriate selection marker (such as the nourseothricin resistance gene nat1) for identifying transformants. The marker gene should be under the control of a strong constitutive promoter such as the trpC promoter to ensure stable expression .

Second, for efficient recombination, use a codon-optimized version of the FLP recombinase gene. Research has demonstrated that native yeast FLP often performs poorly in heterologous systems, whereas codon-optimized versions show significantly improved recombination efficiency. Expression of the recombinase should be controlled by an inducible promoter to allow temporal control of the recombination event .

The complete experimental workflow should include:

  • Primary transformation with the FRT-FTR1-marker cassette

  • Selection of transformants on appropriate media

  • Verification of cassette integration via PCR and Southern blotting

  • Secondary transformation with the codon-optimized FLP recombinase gene

  • Induction of recombinase expression

  • Screening for successful recombination events

  • Confirmation via PCR, sequencing, and functional assays

This approach allows for precise genetic manipulation of FTR1 while enabling marker recycling for multiple sequential modifications .

What are the current methods for analyzing iron transport kinetics in recombinant FTR1-expressing S. cerevisiae strains?

Analysis of iron transport kinetics in recombinant FTR1-expressing strains requires sophisticated methodological approaches to accurately measure iron uptake rates and affinity parameters. The following comprehensive protocol is recommended based on current research practices:

Preparation of cells:

  • Grow recombinant strains in iron-limited media to induce maximum FTR1 expression

  • Harvest cells in mid-logarithmic phase to ensure consistent membrane composition

  • Wash cells thoroughly to remove extracellular iron

  • Resuspend cells to a standardized optical density (typically OD600 = 1.0)

Transport assay:

  • Prepare a range of ⁵⁵Fe²⁺ concentrations (typically 0.1-100 μM)

  • Add cells to iron solutions and incubate for defined time intervals (30 seconds to 10 minutes)

  • Terminate transport by adding ice-cold EDTA solution (5 mM)

  • Collect cells by filtration on glass fiber filters

  • Wash filters with cold buffer to remove unbound iron

  • Measure cell-associated radioactivity using a scintillation counter

Data analysis:

  • Plot initial uptake rates versus iron concentration

  • Fit data to Michaelis-Menten equation to determine Km and Vmax values

  • Compare kinetic parameters between wild-type and recombinant strains

This methodology allows for precise determination of FTR1 transport kinetics and can be used to evaluate the functional impact of specific mutations or regulatory conditions.

How can epitope mapping be applied to identify functional domains in the FTR1 protein?

Epitope mapping provides a powerful approach for identifying functional domains within the FTR1 protein. Based on methodologies used in related research, the following comprehensive protocol is recommended:

First, generate a reference sequence analysis of the FTR1 protein. This can be accomplished by evaluating the protein sequence against CTL (Cytotoxic T Lymphocyte) superfamilies using systems such as the NetCTL-1.2 Server. Epitopes with higher scores (>1.00) indicate stronger binding affinity and are prioritized for further analysis .

Next, identify HTL (Helper T Lymphocyte) epitopes using prediction servers such as IEDB. Select epitopes with low percentile scores (<1.00), as these represent better binding affinity. For B-cell linear epitopes, use prediction methods such as BepiPred 2.0, selecting epitopes with scores above the default threshold of 0.500 .

Surface accessibility is a critical factor for functional domain identification. Utilize Emini's surface accessibility prediction test, selecting regions with values equal to or greater than the default threshold of 1.000. For three-dimensional analysis, employ the ElliPro prediction server to filter out antigenic residues from the 3D model of the FTR1 protein .

The following table summarizes the predicted conformational B-cell epitopes from a similar analysis of FTR1 protein:

No.ResiduesNumber of residuesScore
1F304, F307, K310, R311, A312, A313, I314, R315, K316, A317, E318, A319, G320, E321, W322, D323, D324, G325, D326, E327, A328, E330, N331, Q334, Y335, G337, N338, D339290.731

Using this comprehensive epitope mapping approach allows researchers to identify potential functional domains for targeted mutagenesis studies and structure-function analysis of the FTR1 protein .

What strategies can be employed to optimize recombinant FTR1 expression levels in S. cerevisiae?

Optimizing recombinant FTR1 expression requires a multifaceted approach addressing transcriptional, translational, and post-translational factors. Based on successful strategies in recombinant protein expression, the following methodological framework is recommended:

Promoter selection and modification:

  • Test multiple promoter systems, including constitutive (e.g., GPD, TEF) and inducible promoters (e.g., GAL1, CUP1)

  • For iron-responsive expression, consider incorporating iron-responsive elements from native FTR1 regulatory regions

  • Evaluate promoter strength using reporter gene assays before final construct design

Codon optimization:

  • Analyze the native FTR1 codon usage compared to highly expressed S. cerevisiae genes

  • Adjust rare codons to match the preferred codon bias of S. cerevisiae

  • Maintain critical regulatory secondary structures in the mRNA

The importance of codon optimization cannot be overstated. Research with related recombination systems has demonstrated that codon-optimized genes show dramatically improved functionality compared to native sequences when expressed in heterologous hosts .

Expression vector design:

  • Select appropriate copy number (CEN/ARS for low-copy, 2μ for high-copy)

  • Include selectable markers compatible with the host strain

  • Consider incorporating secretion signals if desired

  • Add epitope tags for detection and purification

Host strain optimization:

  • Select strains with relevant genetic backgrounds (e.g., ftr1Δ for complementation studies)

  • Consider protease-deficient strains to minimize degradation

  • Evaluate iron metabolism mutants for enhanced expression

Culture conditions:

  • Optimize temperature (typically 25-30°C for membrane proteins)

  • Adjust iron availability to modulate native iron regulatory systems

  • Test various induction protocols for inducible promoters

This comprehensive approach addresses multiple factors affecting recombinant FTR1 expression and can be adapted based on specific experimental objectives.

How can recombinant FTR1 systems be utilized to study iron homeostasis mechanisms in yeast?

Recombinant FTR1 systems provide powerful tools for investigating iron homeostasis mechanisms in yeast. A systematic research approach using these systems should include:

First, develop a series of FTR1 variants with modified regulatory regions or protein domains. These can include mutations in iron-responsive elements, post-translational modification sites, or protein-protein interaction domains. Each variant should be expressed in an ftr1Δ background to eliminate interference from the native protein .

Second, implement a multifaceted analytical approach to assess the impact of these modifications on iron homeostasis. This should include measurements of:

  • Total cellular iron content using inductively coupled plasma mass spectrometry (ICP-MS)

  • Subcellular iron distribution using fractionation and analytical techniques

  • Expression profiles of iron-responsive genes using qRT-PCR or RNA-seq

  • Protein-protein interactions using co-immunoprecipitation or proximity labeling

  • Post-translational modifications using mass spectrometry

Third, correlate these measurements with physiological responses such as growth rates under varying iron conditions, resistance to oxidative stress, and metabolic adaptations. This approach allows researchers to establish causal relationships between specific FTR1 features and broader iron homeostasis mechanisms.

The recombinant systems can also be used to investigate cross-talk between iron homeostasis and other cellular processes, including cell cycle regulation, stress responses, and metabolic adaptation. By systematically perturbing FTR1 function and monitoring global cellular responses, researchers can develop comprehensive models of iron regulatory networks in yeast.

What are the potential applications of S. cerevisiae FTR1 knowledge in developing antifungal strategies?

The knowledge gained from studying S. cerevisiae FTR1 has significant potential for developing novel antifungal strategies. Research indicates that FTR1 is a key virulence factor in pathogenic fungi, making it an attractive target for therapeutic interventions .

One promising approach is epitope-based vaccine development targeting FTR1. By identifying conserved epitopes across pathogenic fungi, researchers can design polyvalent vaccines that elicit protective immune responses against multiple fungal pathogens. The comprehensive epitope mapping methodology described earlier provides a foundation for this approach .

For small molecule drug development, the detailed understanding of FTR1 structure and function derived from S. cerevisiae studies enables rational design of inhibitors that could disrupt iron acquisition in pathogenic fungi. Since iron acquisition is essential for pathogen survival in the host environment, such inhibitors could serve as effective antifungals with potentially reduced toxicity compared to current options.

Experimental approaches for pursuing these applications include:

  • Comparative analysis of FTR1 sequences across fungal pathogens to identify conserved features

  • High-throughput screening of compound libraries against recombinant FTR1

  • Structure-based design of peptide mimetics that interfere with FTR1 function

  • In vivo testing of candidate vaccines or inhibitors in animal models of fungal infection

By leveraging the detailed knowledge of FTR1 from the model organism S. cerevisiae, researchers can accelerate the development of novel antifungal strategies targeting this essential iron acquisition system.

What experimental contradictions have emerged in FTR1 research and how can they be resolved?

Several experimental contradictions have emerged in FTR1 research, particularly regarding its regulatory mechanisms and interactions with other iron transport components. These contradictions highlight the complexity of iron homeostasis systems and require careful methodological approaches to resolve.

One significant contradiction involves the relationship between FTR1 and multicopper oxidases. While some studies suggest obligate coupling between these components, others indicate that FTR1 can function independently under certain conditions. To resolve this contradiction, researchers should:

  • Develop assay systems that can distinguish between coupled and uncoupled transport

  • Create recombinant strains expressing tagged versions of both components to monitor their physical association under varying conditions

  • Employ time-resolved analytical techniques to determine the sequence of molecular events during iron transport

Another contradiction concerns the post-translational regulation of FTR1. Some data suggest that phosphorylation enhances FTR1 activity, while other findings indicate that it promotes degradation under iron-replete conditions. A systematic approach to resolve this contradiction includes:

  • Site-directed mutagenesis of putative phosphorylation sites

  • Phosphoproteomic analysis under varying iron conditions

  • Correlation of phosphorylation status with protein stability and transport activity

  • Identification of the kinases and phosphatases involved in FTR1 regulation

These methodological approaches exemplify how researchers can address contradictions in experimental data through systematic investigation, appropriate controls, and integration of multiple analytical techniques.

What are the critical considerations for designing site-directed mutagenesis experiments on the FTR1 gene?

Site-directed mutagenesis of the FTR1 gene requires careful experimental design to generate meaningful insights into protein function. Based on research methodologies in related fields, the following comprehensive approach is recommended:

First, conduct thorough bioinformatic analysis to identify conserved residues across fungal FTR1 homologs. This should include multiple sequence alignment, phylogenetic analysis, and structural predictions. Pay particular attention to:

  • Transmembrane domains predicted to form the iron transport channel

  • REXXE motifs potentially involved in iron binding

  • Conserved cysteine residues that may form disulfide bridges

  • Potential phosphorylation sites and other post-translational modifications

Second, prioritize mutations based on their predicted impact on protein function. Consider creating the following types of mutations:

  • Conservative substitutions to test the importance of specific chemical properties

  • Charge reversals to disrupt electrostatic interactions

  • Alanine scanning of transmembrane regions

  • Cysteine substitutions for subsequent labeling experiments

  • Phosphomimetic mutations (S/T to D/E) to simulate constitutive phosphorylation

Third, implement a recombination-based mutagenesis system such as the FLP/FRT system for efficient generation and testing of mutants . This approach allows for:

  • Marker recycling for creating multiple mutations

  • Integration of mutations at the native locus

  • Controlled expression levels from the native promoter

Fourth, develop a comprehensive phenotypic analysis pipeline to assess the impact of mutations on:

  • Protein expression and localization using fluorescent tags

  • Protein stability and turnover rates using cycloheximide chase

  • Iron transport kinetics using radioisotope uptake assays

  • Growth under varying iron conditions

  • Protein-protein interactions using co-immunoprecipitation

This methodological framework ensures that site-directed mutagenesis experiments yield meaningful insights into FTR1 structure-function relationships.

How can researchers effectively integrate genomic, transcriptomic, and proteomic data in FTR1 studies?

Effective integration of multi-omics data in FTR1 studies requires a systematic methodological approach that addresses the technical challenges of data integration while maximizing biological insights. The following comprehensive framework is recommended:

Data generation strategy:

  • Ensure consistent experimental conditions across omics platforms

  • Include appropriate time points to capture dynamic responses

  • Generate biological replicates for statistical robustness

  • Include relevant control conditions (e.g., iron-replete, iron-depleted)

Genomic analysis:

  • Sequence the FTR1 gene and regulatory regions across strain variants

  • Identify polymorphisms that correlate with phenotypic differences

  • Map transcription factor binding sites in promoter regions

  • Generate targeted mutations for functional validation

Transcriptomic analysis:

  • Measure FTR1 mRNA levels under varying conditions

  • Identify co-regulated genes using network analysis

  • Map transcriptional responses to iron availability

  • Correlate expression patterns with regulatory element variations

Proteomic analysis:

  • Quantify FTR1 protein abundance

  • Map post-translational modifications

  • Identify protein-protein interaction networks

  • Determine subcellular localization under varying conditions

Integrative analysis approaches:

  • Develop correlation networks across omics layers

  • Apply machine learning for pattern recognition

  • Construct predictive models of FTR1 regulation

  • Validate key predictions with targeted experiments

This comprehensive multi-omics approach provides a systems-level understanding of FTR1 function and regulation that cannot be achieved through any single methodology.

What are the emerging trends in FTR1 research that researchers should monitor?

Several emerging trends in FTR1 research warrant close attention from researchers in the field. These trends represent both methodological advances and new conceptual frameworks that are likely to drive significant progress in understanding this important iron transport system.

First, the application of cryo-electron microscopy to membrane transport proteins is revolutionizing our understanding of their structure and function. As this technology continues to improve, it offers the potential to resolve the three-dimensional structure of FTR1 in complex with its partner proteins, potentially revealing the molecular mechanisms of iron transport across the membrane.

Second, the development of genome-wide CRISPR-Cas9 screening approaches allows for comprehensive identification of genetic interactions with FTR1. These screens can reveal unexpected connections between iron homeostasis and other cellular processes, potentially identifying novel regulatory mechanisms and therapeutic targets.

Third, the increasing recognition of FTR1 as a virulence factor in pathogenic fungi is driving interest in its potential as a target for antifungal therapies. The comparative analysis of FTR1 across fungal species, as demonstrated in the epitope mapping studies , provides a foundation for rational drug design approaches targeting this essential protein.

Fourth, the integration of systems biology approaches with traditional biochemical and genetic methods is yielding more comprehensive models of iron homeostasis networks. These integrative approaches are particularly valuable for understanding how FTR1 function is coordinated with other iron acquisition and utilization systems.

By monitoring these trends and incorporating relevant methodologies into their research programs, investigators can position themselves at the forefront of FTR1 research and contribute significantly to this important field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.