Recombinant Saccharomyces cerevisiae Pore and endoplasmic reticulum protein of 33 kDa (PER33)

Shipped with Ice Packs
In Stock

Description

Introduction to PER33

PER33 (YLR064W) is a Saccharomyces cerevisiae transmembrane protein localized predominantly to the endoplasmic reticulum (ER) and nuclear envelope (NE), with partial association with nuclear pore complexes (NPCs). It serves as a paralog to Pom33, a nucleoporin critical for NPC distribution and assembly . PER33 belongs to an evolutionarily conserved protein family, including TMEM33 in humans, which shares structural and functional motifs .

Amino Acid Sequence and Topology

PER33 spans 273 residues (UniProt: Q12144), containing three hydrophobic domains (38–46 amino acids) predicted to form transmembrane or membrane-associated helices . Its C-terminal domain (CTD) is cytosol-facing, enabling interactions with cytoplasmic partners .

Key Features:

FeatureDescription
Length273 amino acids
Transmembrane DomainsPredicted 2–4 transmembrane helices; exact topology debated
CTDCytoplasmic-facing region critical for membrane binding and protein interactions

Evolutionary Conservation

PER33 orthologs exist across eukaryotes, including S. pombe (Tts1) and humans (TMEM33). These proteins share conserved hydrophobic domains and ER/NE localization, suggesting ancestral roles in membrane organization .

Production and Purity of Recombinant PER33

Recombinant PER33 is produced via cell-free systems or heterologous expression in E. coli, yeast, or mammalian cells. Commercial products emphasize high purity and stability:

ParameterDetails
Host SystemsCell-free, E. coli, yeast, baculovirus, mammalian cells
Purity≥85% as determined by SDS-PAGE
StorageTris-based buffer with 50% glycerol; stored at -20°C
ApplicationsELISA, biochemical assays, structural studies

ER-Phagy and Membrane Dynamics

PER33 is implicated in ER-phagy, a process requiring Lnp1, a Lunapark protein stabilizing ER three-way junctions. In lnp1Δ mutants, PER33-GFP fails to translocate to vacuoles, indicating disrupted ER-phagy .

Key Observations:

  • ER-Phagy Defect: lnp1Δ mutants show impaired PER33-GFP cleavage to GFP, confirmed biochemically .

  • Interaction with Lnp1: PER33’s role in ER-phagy suggests functional overlap with Lnp1 in ER quality control .

Membrane Binding and NPC Association

PER33’s CTD interacts with Kap123, a nuclear import factor, though this interaction does not directly mediate NPC targeting. Instead, PER33’s localization depends on membrane curvature and lipid interactions .

Mechanistic Insights:

  • Amphipathic Helices: The CTD contains two α-helices that bind curved membranes, critical for ER/NE association .

  • Kap123 Interaction: While Kap123 binds PER33’s CTD, this interaction is insufficient for NPC recruitment, suggesting redundant targeting mechanisms .

Evolutionary and Functional Parallels

ProteinLocalizationFunctional RoleReference
PER33ER, NE, NPCs (minor)ER-phagy, membrane organization
Pom33NPCs, NENPC assembly, pore distribution
TMEM33ER, NE (human)ER dynamics (inferred)

Lipid Binding

The PER33 CTD preferentially interacts with highly curved membranes, as demonstrated by liposome co-flotation assays. This property aligns with its ER/NE localization, where membrane curvature is pronounced .

Protein Interactions

  • Kap123: Direct binding to the CTD, though not essential for NPC targeting .

  • Lnp1: Indirect interaction via ER-phagy pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PER33; YLR064W; L2177; Pore and endoplasmic reticulum protein of 33 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PER33
Target Protein Sequence
MTVPRNRPMAPFGTIIKSRIKQPQFYWFIGHFLTIFNFIQFHLSITSKQNQLSCYRRSLF YISVTYAIVLYQFFKSDQLKFNFTLLRQEMKKLDNLQYFAMLFILFLLSQFNIIISGSLY SPVIFSIFHFLNYFKENLLPFLPLIPLNLKNLLNSKITVFIQNYNGFFLQMAQVFEIICG LRVGLFLVPFNFFLLLVRRANVSFEVVGTMLAGLTYVWFFKLRYLQSESMRQIFKQYVLR LDAYVSRTLPPYCSRLWNGYKNFVMTVFWKIPV
Uniprot No.

Target Background

Database Links

KEGG: sce:YLR064W

STRING: 4932.YLR064W

Protein Families
PER33/POM33 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus, nuclear pore complex.

Q&A

What is PER33 and how does it relate to other nuclear pore proteins in S. cerevisiae?

PER33 (Pore and Endoplasmic Reticulum protein of 33 kDa) is a paralog of Pom33 in Saccharomyces cerevisiae. While both proteins can associate with Nuclear Pore Complexes (NPCs), they exhibit distinct localization patterns. Pom33 is an integral membrane protein primarily found in NPCs, whereas PER33 is mainly localized at the Endoplasmic Reticulum (ER) and nuclear envelope, with only partial association with NPCs . This differential localization suggests distinct but potentially overlapping functions in cellular membrane organization. Understanding these differences is crucial for researchers investigating nuclear-cytoplasmic transport mechanisms.

What are the structural characteristics of PER33 that determine its subcellular localization?

The subcellular localization of PER33 to the ER and nuclear envelope, as opposed to the exclusive NPC localization of its paralog Pom33, likely results from specific structural determinants. Research on related proteins suggests that membrane-binding domains play critical roles in proper targeting. For instance, the C-terminal domain (CTD) of Pom33 contains amphipathic α-helices that preferentially bind to highly curved lipid membranes, as demonstrated through circular dichroism and liposome co-flotation assays . This membrane-binding capacity works in conjunction with nuclear transport factors like Kap123 to ensure proper localization. For PER33, researchers should investigate whether similar structural elements exist and how they might differ to explain its preferential ER localization.

How does PER33 expression change under different cellular conditions?

PER33 expression patterns can vary significantly depending on cellular conditions. Researchers studying PER33 should examine expression datasets to identify conditions that up- or down-regulate this protein . Methodologically, this requires:

  • RT-qPCR analysis comparing PER33 mRNA levels across growth phases and stress conditions

  • Western blot analysis with antibodies against PER33 or epitope-tagged versions

  • Fluorescence microscopy of GFP-tagged PER33 under different conditions

  • Correlation of expression data with cellular phenotypes

When designing such experiments, researchers should include appropriate controls and normalize expression data to stable reference genes to enable meaningful comparisons across conditions.

How do the functional roles of PER33 differ from its paralog Pom33 in nuclear pore biology?

While Pom33 is essential for proper NPC distribution and assembly in yeast, PER33's role appears more nuanced. Methodologically, researchers should approach this question through:

  • Comparative phenotypic analysis of Δper33 and Δpom33 mutants

  • Double knockout studies to detect functional redundancy

  • Domain-swapping experiments between PER33 and Pom33

  • Protein-protein interaction studies to identify unique binding partners

A systematic investigation approach should employ both unbiased screens and targeted analyses, tracking phenotypes related to nuclear transport, ER function, and cell cycle progression. These studies would help elucidate whether PER33 serves primarily as a backup for Pom33 function or has evolved distinct cellular roles.

What protein-protein interaction networks involve PER33?

Identifying the interaction partners of PER33 is crucial for understanding its biological function. Methodological approaches include:

  • Affinity purification coupled with mass spectrometry (AP-MS)

  • Yeast two-hybrid screening

  • Proximity-based labeling methods (BioID, APEX)

  • Co-immunoprecipitation followed by western blotting for candidate interactors

When designing interaction studies, researchers should consider that membrane proteins like PER33 may require specialized protocols to maintain native conformations and preserve genuine interactions. Controls should include paralog Pom33 to distinguish shared versus unique interaction partners.

How does membrane curvature influence PER33 localization and function?

Given that Pom33's C-terminal domain preferentially binds highly curved membranes , researchers should investigate whether PER33 exhibits similar properties. Methodological approaches should include:

  • In vitro membrane binding assays using liposomes of varying curvature

  • Microscopy studies correlating PER33 localization with membrane curvature markers

  • Mutagenesis of predicted curvature-sensing domains

  • Comparison with known curvature-sensitive proteins

Results from these experiments would reveal whether PER33's localization to the ER and nuclear envelope depends on specific membrane curvature preferences, potentially explaining its distinct localization pattern compared to Pom33.

What are the optimal strategies for recombinant expression of PER33 in S. cerevisiae?

For optimal recombinant expression of PER33 in S. cerevisiae, researchers should consider:

Expression System ComponentRecommended OptionsConsiderations
PromoterTEF1, TPI1, GPDTEF1 and TPI1 promoters shown to provide strong constitutive expression
Secretion Leaderα-factor, synthetic leaderInclude KOZAK sequence (aacaaa) to increase translation efficiency
Plasmid SystemPOT1-based vectorsPOT1 complementation allows increased plasmid copy number for high expression
Strain BackgroundProtease-deficient strainsReduces proteolytic degradation of recombinant proteins
Induction ConditionsGlucose medium for constitutive promotersMonitor growth rates for optimal harvest timing

When expressing membrane proteins like PER33, researchers should include a Kex2 site (aaaaga) and spacer sequence (gaagaaggtgaaccaaaa) between the leader and protein coding sequence to increase cleavage efficiency in the secretory pathway . Expression levels should be monitored by western blotting and effects on cellular growth to ensure construct stability.

How should researchers design epitope tagging strategies for PER33 functional studies?

When designing epitope tagging strategies for PER33:

  • Consider tag placement carefully as N-terminal tags may disrupt signaling sequences while C-terminal tags could affect membrane insertion domains

  • Validate tagged constructs by comparing localization patterns to untagged PER33

  • Use short, hydrophilic tags (FLAG, HA, V5) to minimize disruption of membrane protein topology

  • Include flexible linker sequences between the tag and PER33 to reduce functional interference

For functional validation, complementation assays should confirm whether tagged PER33 can rescue any phenotypes observed in PER33 deletion mutants. Microscopy studies should compare the localization of tagged constructs with published data on native PER33 distribution.

What microscopy techniques are most effective for studying PER33 subcellular localization?

For optimal visualization of PER33:

TechniqueApplicationAdvantagesLimitations
Confocal MicroscopyCo-localization studiesGood optical sectioning, multi-channel capabilityLimited resolution for fine ER structure
Super-resolution Microscopy (SIM, STED)Detailed localization analysisImproved resolution beyond diffraction limitComplex sample preparation, potential artifacts
Correlative Light-Electron MicroscopyUltra-structural contextCombines protein localization with ultrastructureTechnically challenging, specialized equipment
Live-cell ImagingDynamic localization studiesCaptures protein movement and responsesPotential phototoxicity, lower signal

Researchers should co-stain with established ER and nuclear pore markers to definitively assign PER33 localization. For high-quality images, sample preparation should optimize fixation conditions to preserve membrane structures while maintaining antigen accessibility for immunofluorescence approaches.

How can researchers effectively analyze PER33 dynamics in living cells?

To capture PER33 dynamics:

  • Generate stable S. cerevisiae strains expressing PER33-GFP (or other fluorescent protein) fusions integrated at the native locus

  • Use photobleaching techniques (FRAP, FLIP) to measure protein mobility within membranes

  • Employ photoactivatable or photoswitchable fluorescent proteins to track newly synthesized protein

  • Implement temperature-sensitive mutants or drug treatments to perturb specific cellular processes

Analysis should include quantification of recovery kinetics after photobleaching to determine if PER33 is freely diffusing or constrained by protein-protein interactions. Time-lapse imaging during cell cycle progression can reveal potential changes in localization patterns related to nuclear envelope dynamics.

What are the advantages of using S. cerevisiae for studying PER33 function?

S. cerevisiae offers multiple advantages as a model system for PER33 studies:

  • Well-annotated genome and expansive molecular toolbox facilitating genetic manipulations

  • Strong conservation of basic eukaryotic biology, including nuclear pore complex organization

  • Rapid growth and ease of manipulation for high-throughput experimental approaches

  • Ability to perform systematic studies through comprehensive knockout collections

Proteome comparisons between S. cerevisiae and 704 other organisms have identified the pathways and processes for which yeast serves as a good model system . For nuclear envelope biology specifically, many fundamental mechanisms are conserved between yeast and higher eukaryotes, making findings on PER33 potentially transferable to understanding related proteins in other organisms.

What are the limitations of the S. cerevisiae model for extrapolating PER33 findings to other organisms?

Despite its utility, researchers should recognize the following limitations:

  • Differences in nuclear envelope breakdown during mitosis (closed mitosis in yeast versus open mitosis in many higher eukaryotes)

  • Some pathways have evolved additional complexity in higher organisms

  • Post-translational modification patterns may differ between yeast and other eukaryotes

  • Certain specialized cell functions are absent in unicellular yeast

The proper approach is to validate key findings from yeast models in other systems, particularly when exploring potential biomedical applications. Researchers should use systematic methods to assess whether specific pathways involving PER33 are conserved in the target organisms of interest .

How should researchers approach conflicting data in PER33 functional studies?

When faced with conflicting results regarding PER33 function:

  • Systematically evaluate experimental conditions to identify variables that might explain discrepancies

  • Consider strain background differences that could affect observations

  • Test whether fusion tags or expression levels might influence results

  • Design orthogonal approaches to validate key findings through independent methods

A structured approach involves creating a comprehensive table of experimental variables across studies, systematically testing each parameter while keeping others constant. This approach helps identify which specific conditions lead to divergent results, potentially revealing context-dependent aspects of PER33 function.

What bioinformatics tools are most valuable for analyzing PER33 evolution and conservation?

For evolutionary analysis of PER33:

Analysis TypeRecommended ToolsApplication
Sequence AlignmentMUSCLE, T-Coffee, MAFFTCompare PER33 sequences across species
Phylogenetic AnalysisRAxML, MrBayes, IQ-TREEReconstruct evolutionary relationships
Structural PredictionAlphaFold, RoseTTAFoldPredict protein structure from sequence
Domain IdentificationInterPro, SMART, PfamIdentify functional domains and motifs
Coevolution AnalysisCAPS, DCA, EV-CouplingDetect coevolving positions within protein

When conducting evolutionary analyses, researchers should consider both orthology (genes related by speciation) and paralogy (genes related by duplication) relationships. For PER33, this means comparing not only to PER33-like proteins in other species but also to paralogs like Pom33 within the same species to understand functional divergence after gene duplication events.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.