Recombinant Saccharomyces cerevisiae Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase (SLC1)

Shipped with Ice Packs
In Stock

Description

Introduction

Saccharomyces cerevisiae Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase, commonly referred to as SLC1, is an enzyme involved in glycerophospholipid metabolism, glycerolipid metabolism, and ether lipid metabolism . It is found in yeast and is similar to human, Drosophila, and Caenorhabditis cytoplasmic dynein light chains 1 . In yeast, Slc1p and Ale1p produce phosphatidic acid de novo by way of 1-acyl-sn-glycerol-3-phosphate acyltransferases .

Function and Enzymatic Activity

SLC1 is an acyltransferase that belongs to a family of transferases. Its systematic name is acyl-CoA:1-acyl-sn-glycerol-3-phosphate 2-O-acyltransferase .
SLC1 catalyzes this chemical reaction :
acyl-CoA + 1-acyl-sn-glycerol 3-phosphate → CoA + 1,2-diacyl-sn-glycerol 3-phosphate

Other common names for SLC1 :

  • 1-acyl-sn-glycero-3-phosphate acyltransferase

  • 1-acyl-glycerol 3-phosphate acyltransferase

  • 1-acylglycero-3-phosphate acyltransferase

  • 1-acylglycerolphosphate acyltransferase

  • 1-acylglycerophosphate acyltransferase

  • lysophosphatidic acid-acyltransferase

SLC1 transfers a fatty acid from fatty acyl-CoA to the sn-1 position of glycerol-3-phosphate, which then produces lysophosphatidic acid (LysoPA) . These resulting lipids are not only precursors for glycerolipid synthesis but also affect cell signaling .

Role in Lipid Synthesis

Slc1p is essential for the synthesis of phosphatidic acid, a precursor for triacylglycerols and glycerophospholipids .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SLC1; YDL052C; 1-acyl-sn-glycerol-3-phosphate acyltransferase; 1-AGP acyltransferase; 1-AGPAT; Lysophosphatidic acid acyltransferase; LPAAT; Sphingolipid compensation protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SLC1
Target Protein Sequence
MSVIGRFLYYLRSVLVVLALAGCGFYGVIASILCTLIGKQHLAQWITARCFYHVMKLMLG LDVKVVGEENLAKKPYIMIANHQSTLDIFMLGRIFPPGCTVTAKKSLKYVPFLGWFMALS GTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQ GKIPIVPVVVSNTSTLVSPKYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVD TLKEIGYSPAINDTTLPPQAIEYAALQHDKKVNKKIKNEPVPSVSISNDVNTHNEGSSVK KMH
Uniprot No.

Target Background

Function
This acyltransferase catalyzes the sn-2-specific, acyl-CoA-dependent acylation of lysophosphatidic acid (LPA) to phosphatidic acid (PA) within lipid particles. In conjunction with ALE1, it plays a crucial role in PA biosynthesis, an intermediate in the synthesis of all glycerophospholipids. It also exhibits acyltransferase activity toward lysophosphoinositol (LPI) and lysophosphoserine (LPS). The enzyme accepts various fatty acyl-CoAs as substrates, including 18:1-acyl-CoA, 14:0-acyl-CoA, 12:0-acyl-CoA, and 10:0-acyl-CoA.
Gene References Into Functions
  1. Topology of 1-acyl-sn-glycerol-3-phosphate acyltransferases SLC1 and ALE1 and related membrane-bound O-acyltransferases (MBOATs) of Saccharomyces cerevisiae. PMID: 21849510
  2. Transgenic soybean somatic embryos expressing the yeast SLC1 gene exhibit increased triacylglycerol content. PMID: 19768478
  3. Slc1p and Slc4p may function not only as 1-acylglycerol-3-phosphate O-acyltransferases but also participate in fatty acid exchange at the sn-2 position of mature glycerophospholipids. PMID: 17675291
  4. Lpt1p, a member of the membrane-bound O-acyltransferase gene family, appears to collaborate with Slc1 in mediating the incorporation of unsaturated acyl chains into the sn-2 position of phospholipids. PMID: 17726007
  5. In collaboration with Slc1, Lpt1 plays a central role in phosphatidic acid biosynthesis, which is essential for cell viability. PMID: 17890783
Database Links

KEGG: sce:YDL052C

STRING: 4932.YDL052C

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Lipid droplet.

Q&A

What is SLC1 and what is its primary function in Saccharomyces cerevisiae?

SLC1 (1-acyl-sn-glycerol-3-phosphate acyltransferase) in Saccharomyces cerevisiae is an enzyme involved in phospholipid biosynthesis that catalyzes the acylation of lysophosphatidic acid to form phosphatidic acid, a critical intermediate in glycerophospholipid synthesis. This enzyme plays a fundamental role in lipid metabolism and membrane biogenesis in yeast cells, contributing to cellular membrane integrity and function . Recent research has demonstrated that SLC1 is required to maintain tubular mitochondrial morphology and normal mitochondrial functions, indicating its importance beyond basic lipid synthesis . The absence of SLC1 has been shown to cause mitochondrial fragmentation, increase mitochondrial fission frequency, reduce mitochondrial respiration, and slow down nitrogen starvation-induced mitophagy .

Additionally, SLC1 significantly influences the regulation of lipid droplets by affecting the protein level of Ptl2, a triacylglycerol lipase localized on lipid droplets . These functions are dependent on SLC1's acyltransferase enzymatic activity, highlighting the critical nature of this catalytic function to its biological roles. Understanding these fundamental aspects of SLC1 provides the foundation for more advanced research questions and therapeutic applications targeting lipid metabolism disorders.

How does SLC1 relate to the broader solute carrier (SLC) superfamily?

Unlike some other SLC family members that transport molecules across plasma membranes, SLC1 catalyzes biochemical reactions involved in phospholipid synthesis. This functional diversity within the SLC superfamily highlights the evolutionary versatility of this protein group. The SLC superfamily remains understudied despite its importance, with limited biological tools, specific reagents, and dedicated databases available for research . These limitations have hampered the development of new chemical entities able to modulate SLC activity, including SLC1, making it an important area for continued research and characterization.

What are the structural characteristics of SLC1 protein?

The structural characteristics of SLC1 from Saccharomyces cerevisiae include several conserved domains that are essential for its acyltransferase activity. Structurally, SLC1 contains transmembrane domains that anchor it to the membrane, as well as catalytic domains responsible for its enzymatic function. The protein exists as a monomer in its natural state, as confirmed by size exclusion chromatography studies of recombinant proteins with similar structures . SLC1 contains conserved motifs typical of acyltransferases, including the HX4D motif that is critical for catalytic activity.

What are the optimal conditions for recombinant expression of SLC1 in bacterial systems?

For optimal recombinant expression of SLC1 in bacterial systems, researchers should consider implementing a strategy similar to that used for other yeast proteins. Expression should be conducted in E. coli BL21(DE3) cells transformed with a vector containing the SLC1 gene downstream of a bacteriophage T7 inducible promoter and lac operator, such as pET21d(+) . The expression construct should include a C-terminal His-tag to facilitate purification using immobilized metal affinity chromatography (IMAC) . Optimal growth conditions typically involve culturing cells at 37°C until an OD600 of 0.6-0.8 is reached, followed by induction with IPTG at a concentration of 0.5-1.0 mM .

Post-induction, the temperature should be lowered to 18-20°C for 16-18 hours to enhance protein solubility and proper folding . Cell lysis should be performed using sonication or high-pressure homogenization in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors. For membrane-associated proteins like SLC1, the addition of mild detergents such as 0.1-0.5% Triton X-100 or n-dodecyl-β-D-maltoside (DDM) to the lysis buffer is essential to solubilize the protein from membranes. Purification via IMAC should be followed by size exclusion chromatography to obtain homogeneous protein preparations suitable for further biochemical and structural studies .

How can SLC1 protein purity be assessed after recombinant expression?

For more rigorous purity assessment, size exclusion chromatography (SEC) should be implemented to analyze the homogeneity of the protein preparation and determine the oligomeric state of SLC1 under native conditions . A single, symmetrical peak in the SEC chromatogram indicates a homogeneous preparation. Additionally, dynamic light scattering (DLS) can be used to evaluate sample polydispersity, with values below 20% suggesting suitable homogeneity for structural studies. Mass spectrometry, particularly matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) or electrospray ionization mass spectrometry (ESI-MS), provides precise molecular weight determination and can confirm post-translational modifications or the presence of contaminants. For the highest standards of purity assessment, analytical ultracentrifugation can determine both the sedimentation coefficient and the molecular weight of the protein in solution.

What experimental approaches can be used to verify the acyltransferase activity of recombinant SLC1?

Verification of recombinant SLC1 acyltransferase activity requires multiple complementary approaches to confirm both the catalytic function and substrate specificity. The primary assay should measure the acylation of lysophosphatidic acid to form phosphatidic acid using thin-layer chromatography (TLC) or high-performance liquid chromatography (HPLC) coupled with mass spectrometry . For TLC analysis, radiolabeled substrates (e.g., 14C-labeled acyl-CoA) can be used to enhance sensitivity, with reaction products separated on silica plates and quantified by autoradiography or phosphorimaging. HPLC-based assays offer higher sensitivity and can be optimized using experimental design approaches as detailed in analytical method development literature .

For more sophisticated analyses, a coupled enzyme assay can be developed where CoA released during the acyltransferase reaction is measured spectrophotometrically using auxiliary enzymes such as pyruvate dehydrogenase. Researchers should also conduct enzyme kinetic studies to determine Km and Vmax values for various substrates, which provides insights into substrate preference and catalytic efficiency. Additionally, site-directed mutagenesis of conserved catalytic residues should be performed to confirm their role in enzymatic activity. Phenotypic rescue experiments in SLC1-deficient yeast strains can provide functional validation, particularly by assessing the restoration of normal mitochondrial morphology and lipid droplet regulation . Control experiments should include heat-inactivated enzyme and catalytically inactive mutants to confirm that observed activity is specifically due to SLC1.

What cell-based assay platforms are most effective for studying SLC1 function?

Several cell-based assay platforms can be effectively employed to study SLC1 function, with selection dependent on the specific aspect of SLC1 biology under investigation. For studying SLC1's role in phospholipid metabolism, lipidomic analyses using liquid chromatography-mass spectrometry (LC-MS) can quantify changes in phospholipid profiles in response to SLC1 manipulation . When investigating SLC1's impact on mitochondrial function, fluorescent dyes such as MitoTracker or JC-1 can be used to assess mitochondrial membrane potential, while Seahorse XF analyzers can measure oxygen consumption rates to evaluate mitochondrial respiration in cells with altered SLC1 expression .

For analyzing SLC1's effects on lipid droplet dynamics, BODIPY or Nile Red staining coupled with fluorescence microscopy or flow cytometry enables quantification of lipid droplet size, number, and distribution . To assess protein-protein interactions involving SLC1, proximity ligation assays, fluorescence resonance energy transfer (FRET), or bimolecular fluorescence complementation (BiFC) can be employed. For genetic manipulations of SLC1, CRISPR-Cas9 gene editing provides precise modification capabilities, while inducible expression systems allow temporal control of SLC1 expression to distinguish between acute and adaptive cellular responses . When using cell-based assays, it is crucial to consider the cellular localization of SLC1, as approximately half of all SLCs localize at least partially to the plasma membrane, while others, including SLC1, may reside in intracellular compartments .

How can researchers effectively design experiments to investigate SLC1's role in mitochondrial regulation?

Designing effective experiments to investigate SLC1's role in mitochondrial regulation requires a multi-faceted approach combining genetic manipulation, imaging techniques, and functional assays. Researchers should begin by establishing appropriate yeast models with wild-type, SLC1 knockout, and rescue lines expressing either functional or catalytically inactive SLC1 mutants . Complementary approaches should include both constitutive knockouts and inducible systems to distinguish between acute effects and adaptive responses following SLC1 depletion . Time-course studies following SLC1 inhibition or degradation using targeted protein degradation approaches can provide valuable insights into the temporal dynamics of mitochondrial changes .

For mitochondrial morphology assessment, researchers should implement high-resolution confocal microscopy with mitochondria-targeted fluorescent proteins (e.g., mito-GFP) or MitoTracker dyes, complemented by transmission electron microscopy for ultrastructural analysis . Mitochondrial dynamics can be quantified by measuring fission and fusion events using photoactivatable fluorescent proteins or fluorescence recovery after photobleaching (FRAP). Functional analyses should include oxygen consumption rate measurements using respirometry, membrane potential assessment with potentiometric dyes (e.g., TMRM, JC-1), and ATP production assays . Researchers should also investigate mitophagy by monitoring the colocalization of mitochondria with autophagy markers like Atg8/LC3 during starvation or other stress conditions . Additionally, lipidomic analysis of mitochondrial membranes can reveal alterations in phospholipid composition resulting from SLC1 dysfunction, potentially linking lipid metabolism to mitochondrial structural changes.

What strategies can be employed to analyze the relationship between SLC1 and lipid droplet regulation?

Biochemical approaches should include lipidomic analysis using mass spectrometry to quantify triacylglycerol and sterol ester content in isolated lipid droplets, complemented by proteomic analysis to identify changes in the lipid droplet proteome resulting from SLC1 deficiency . Particular attention should be paid to the protein levels of Ptl2, a triacylglycerol lipase whose abundance is increased in the absence of SLC1 . Enzymatic activity assays for lipases, including Ptl2, should be performed to determine whether the observed changes in protein levels correlate with altered lipolytic activity. Additionally, researchers should investigate the phosphorylation status of lipid droplet proteins, as post-translational modifications often regulate lipid metabolism.

For genetic approaches, epistasis analysis with genes encoding other lipid droplet-associated proteins can reveal functional relationships. Specifically, double knockout studies combining SLC1 deletion with Ptl2 deletion would help determine whether the increased Ptl2 levels observed in SLC1-deficient cells are causally linked to the observed phenotypes . RNA-sequencing analysis can identify transcriptional changes in lipid metabolism genes resulting from SLC1 deficiency, potentially uncovering compensatory mechanisms.

How does SLC1 acyltransferase activity influence phospholipid composition and membrane properties?

SLC1 acyltransferase activity exerts profound effects on phospholipid composition and membrane properties through its catalytic function in transferring acyl groups to lysophosphatidic acid, forming phosphatidic acid - a critical intermediate in phospholipid biosynthesis. This enzymatic activity directly influences the fatty acid composition of resulting phospholipids, thereby affecting membrane fluidity, thickness, and curvature . The acyltransferase activity of SLC1 shows preference for specific acyl-CoA donors, leading to the incorporation of particular fatty acids at the sn-2 position of glycerophospholipids. This positional specificity contributes to the asymmetric distribution of fatty acids in membrane phospholipids, which is essential for proper membrane function and organization.

In SLC1-deficient cells, altered phospholipid composition has been observed, particularly affecting mitochondrial membranes where changes in cardiolipin and phosphatidylethanolamine levels can disrupt mitochondrial morphology and function . These changes in lipid composition affect membrane properties crucial for mitochondrial fusion and fission, explaining the mitochondrial fragmentation phenotype observed in SLC1-deficient cells . Furthermore, SLC1's acyltransferase activity influences the balance between phospholipid synthesis and triacylglycerol formation, thereby affecting the distribution of lipids between membranes and storage in lipid droplets . Advanced lipidomic analyses have revealed that SLC1 deficiency alters not only the total phospholipid content but also the species distribution within phospholipid classes, suggesting that SLC1 plays a role in maintaining the diversity of the cellular lipidome necessary for proper membrane function in different cellular compartments.

What molecular mechanisms link SLC1 function to mitochondrial dynamics and morphology?

The molecular mechanisms linking SLC1 function to mitochondrial dynamics and morphology involve complex interplays between phospholipid metabolism and mitochondrial membrane properties. SLC1's acyltransferase activity directly contributes to the synthesis of phospholipids essential for mitochondrial membranes, particularly phosphatidylethanolamine and cardiolipin, which are critical for maintaining proper mitochondrial morphology . In the absence of SLC1, the altered phospholipid composition compromises the physical properties of mitochondrial membranes, including curvature elasticity and lateral pressure profiles, which are essential for the activities of proteins involved in mitochondrial fusion and fission.

Research has demonstrated that SLC1 deficiency increases mitochondrial fission frequency, resulting in fragmented mitochondria rather than the typical tubular networks . This phenotype suggests that SLC1 either directly inhibits the mitochondrial fission machinery or promotes fusion processes. The increased fission may result from altered recruitment or activity of dynamin-related GTPases like Dnm1 (yeast homolog of DRP1) to mitochondria due to changes in membrane composition. Additionally, SLC1 deficiency reduces mitochondrial respiration capacity, suggesting functional consequences beyond morphological changes . This respiratory defect may arise from disrupted assembly or stability of respiratory chain complexes due to altered membrane environments.

Furthermore, SLC1 deletion slows down nitrogen starvation-induced mitophagy, indicating its involvement in quality control mechanisms for damaged mitochondria . This impaired mitophagy may result from defective recognition of damaged mitochondria by the autophagy machinery due to alterations in membrane composition or from disrupted interaction between mitochondria and the endoplasmic reticulum at contact sites, which are important for mitophagy initiation. The discovery that these phenotypes depend on SLC1's acyltransferase enzymatic activity confirms that the lipid metabolic function of SLC1 is mechanistically linked to mitochondrial dynamics and morphology .

How do genetic variations in SLC1 affect its function and cellular phenotypes?

Genetic variations in SLC1 can substantially impact its enzymatic function and subsequently influence cellular phenotypes through various mechanisms. Mutations in the catalytic domain, particularly those affecting the active site residues responsible for acyl-CoA binding or catalysis, can diminish or eliminate acyltransferase activity. Research has demonstrated that the phenotypes associated with SLC1 deficiency, including mitochondrial fragmentation and altered lipid droplet regulation, depend on its enzymatic activity . This indicates that mutations compromising catalytic function would likely reproduce the knockout phenotype, even if the protein is still expressed.

Variations in regulatory regions of SLC1 can alter its expression levels, leading to either insufficient activity or overexpression effects. Since SLC1 plays a critical role in phospholipid metabolism, dosage changes can disrupt the balance between different lipid biosynthetic pathways. Mutations affecting protein stability or folding may lead to reduced protein levels due to degradation of misfolded proteins, as has been observed with other acyltransferases that show characteristic negative minima at 222 and 208 nm in CD spectra when properly folded . Additionally, variations affecting subcellular localization signals may mislocalize SLC1, preventing it from accessing its substrates or interacting partners in the correct cellular compartments.

Mutations in protein-protein interaction domains could disrupt SLC1's association with regulatory proteins or multi-enzyme complexes involved in lipid metabolism. Comparative studies using PIPSA (Protein Interaction Property Similarity Analysis) have shown that related proteins can be identified across species based on their interaction properties, suggesting that certain surface features of SLC1 are likely conserved for functional interactions . Finally, polymorphisms affecting post-translational modification sites could alter regulation of SLC1 activity in response to cellular signals. Advanced genetic approaches, including site-directed mutagenesis combined with functional assays, are essential for characterizing how specific genetic variations impact SLC1 function and the resulting cellular phenotypes.

What experimental design approaches are most appropriate for optimizing SLC1 expression and purification?

Optimizing SLC1 expression and purification requires a systematic experimental design approach that efficiently explores multiple variables while minimizing the number of experiments. Response Surface Methodology (RSM), particularly Central Composite Design (CCD) or Box-Behnken Design (BBD), is highly appropriate for this purpose as these designs enable the evaluation of multiple factors simultaneously while identifying optimal conditions and potential interactions between variables . For SLC1 expression, key factors to optimize include inducer concentration (IPTG), induction temperature, induction duration, media composition, and cell density at induction. A three-level BBD would be particularly suitable as it requires fewer experiments than CCD while still providing sufficient data to model quadratic effects .

For purification optimization, factors including buffer pH, salt concentration, imidazole concentration (for IMAC), and detergent type/concentration (for membrane protein extraction) should be systematically varied. D-optimal design can be employed when constraints exist on certain factor combinations or when irregular experimental regions must be explored . Additionally, for multi-step purification processes, sequential experimental designs can be implemented, where the optimized conditions from one step feed into the design of the next step.

The experimental data should be analyzed using response surface analysis to generate mathematical models describing the relationship between factors and responses (protein yield, purity, and activity). Statistical software packages can then identify optimal conditions through numerical optimization of the generated models. Verification experiments under the predicted optimal conditions are essential to confirm model accuracy. This systematic approach significantly reduces the time and resources required compared to traditional one-factor-at-a-time methods, while also revealing interactive effects between variables that might otherwise be missed .

How can researchers effectively analyze and interpret data from SLC1 functional studies?

Effective analysis and interpretation of data from SLC1 functional studies require rigorous statistical approaches combined with appropriate controls and contextual understanding of SLC1's biological roles. For studies comparing wild-type and SLC1-deficient cells, researchers should implement appropriate statistical tests based on data distribution, with parametric tests (t-test, ANOVA) for normally distributed data and non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data. Multiple comparison corrections (e.g., Bonferroni, Benjamini-Hochberg) should be applied when testing multiple hypotheses to control false discovery rates.

For time-course experiments examining SLC1's effects on processes like mitochondrial dynamics or lipid droplet formation, mixed-effects models or repeated measures ANOVA should be employed to account for the correlation structure of the data. When investigating relationships between SLC1 expression levels and phenotypic outcomes, regression analyses can quantify the strength and nature of associations. For complex datasets from omics approaches (lipidomics, proteomics), multivariate statistical methods such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can identify patterns and key contributing variables.

What approaches can be used to study SLC1 interactions with other proteins in lipid metabolism pathways?

Studying SLC1 interactions with other proteins in lipid metabolism pathways requires a complementary set of approaches to identify, validate, and characterize these interactions in their native cellular context. Initially, affinity purification coupled with mass spectrometry (AP-MS) using tagged SLC1 as bait can identify potential protein interactors from cell lysates. For membrane proteins like SLC1, crosslinking prior to lysis can stabilize transient interactions, while detergent selection is critical for maintaining native interactions during solubilization. Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling provides an alternative approach that captures both stable and transient interactions in living cells, which is particularly valuable for membrane-associated proteins like SLC1.

For validation of identified interactions, co-immunoprecipitation followed by western blotting confirms binary interactions, while fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) provides evidence for interactions in living cells. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) with purified proteins can determine binding affinities and kinetics of confirmed interactions. Proximity ligation assay (PLA) is particularly useful for detecting endogenous protein interactions without overexpression artifacts.

To understand the functional significance of identified interactions, genetic approaches including double knockout studies and synthetic genetic array (SGA) analysis can reveal functional relationships between SLC1 and its interactors. CRISPR-Cas9 mediated mutagenesis of specific domains can determine regions required for particular interactions. For complex formation analysis, blue native PAGE or size exclusion chromatography combined with multi-angle light scattering (SEC-MALS) can determine the stoichiometry and molecular weight of protein complexes involving SLC1. Additionally, structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy of SLC1 in complex with interacting partners can provide detailed molecular insights into the interaction interfaces and mechanisms of functional cooperation in lipid metabolism pathways.

What are the most promising future research directions for SLC1 studies?

The most promising future research directions for SLC1 studies span multiple areas of investigation, from structural biology to systems-level analyses and potential therapeutic applications. High-resolution structural determination of SLC1 using cryo-electron microscopy or X-ray crystallography represents a critical objective that would provide unprecedented insights into the catalytic mechanism and substrate specificity determinants. Such structural information would facilitate structure-based drug design targeting SLC1 for potential therapeutic interventions in disorders of lipid metabolism. Additionally, developing selective small molecule modulators (both inhibitors and activators) of SLC1 would provide valuable chemical biology tools for acute perturbation studies, overcoming limitations of genetic approaches where compensatory mechanisms may obscure primary functions .

Investigating the regulatory mechanisms controlling SLC1 activity, including post-translational modifications and protein-protein interactions, represents another promising direction. Comprehensive proteomic approaches combined with functional studies could elucidate how SLC1 activity is modulated in response to cellular metabolic states and stress conditions. Systems biology approaches integrating transcriptomic, proteomic, and lipidomic data from SLC1-deficient cells could reveal the broader impact of SLC1 on cellular metabolism and identify unexpected connections to other biological processes.

Given SLC1's role in mitochondrial function and lipid droplet regulation , exploring its potential involvement in age-related diseases, including neurodegenerative disorders where mitochondrial dysfunction is a key contributor, represents a particularly promising translational direction. Additionally, investigating SLC1 function in multicellular model organisms would extend current yeast-based findings to more complex biological systems, potentially revealing tissue-specific roles. Finally, leveraging advances in spatial lipidomics and single-cell technologies could provide unprecedented insights into how SLC1-mediated lipid metabolism contributes to cellular heterogeneity and specialized functions in different cell types or subcellular compartments.

How might advances in SLC1 research contribute to understanding broader lipid metabolism disorders?

Advances in SLC1 research have significant potential to enhance our understanding of broader lipid metabolism disorders through several mechanistic connections. SLC1's central role in phospholipid biosynthesis positions it as a key regulator of membrane composition and properties, which are frequently disrupted in metabolic diseases . By elucidating how SLC1 activity influences the balance between membrane phospholipid synthesis and triacylglycerol storage in lipid droplets, researchers can gain insights into conditions characterized by abnormal lipid storage, such as hepatic steatosis or lipodystrophies.

The discovery that SLC1 regulates mitochondrial morphology and function establishes a direct link between phospholipid metabolism and mitochondrial biology . This connection is particularly relevant for understanding diseases where mitochondrial dysfunction plays a central role, including neurodegenerative disorders, diabetes, and cardiovascular diseases. The observation that SLC1 deficiency increases mitochondrial fragmentation and reduces respiratory capacity suggests that altered phospholipid metabolism may contribute to the mitochondrial defects observed in these conditions .

Furthermore, SLC1's influence on lipid droplet dynamics through regulation of Ptl2 levels provides a mechanistic framework for understanding disorders of lipid storage and mobilization . By characterizing how SLC1 activity coordinates lipid synthesis with lipid droplet formation and lipolysis, researchers can identify potential therapeutic targets for conditions involving dysregulated lipid storage such as obesity. The acyltransferase activity of SLC1 also influences the fatty acid composition of phospholipids, which affects membrane fluidity and signaling properties. This aspect of SLC1 function may contribute to understanding disorders where altered membrane composition impacts cellular signaling, including insulin resistance and neurological conditions.

Finally, as part of the understudied SLC superfamily, advances in SLC1 research contribute to the broader effort to unlock this important group of proteins for drug discovery . Development of methodologies and assays for studying SLC1 can be applied to other SLC family members, potentially accelerating progress across multiple disease areas where SLCs play critical roles.

What are the key methodological challenges that need to be addressed in SLC1 research?

Several key methodological challenges must be addressed to advance SLC1 research, each requiring innovative approaches and technical developments. One of the primary challenges is the development of selective inhibitors or modulators for SLC1, as such tools would enable acute perturbation studies to distinguish primary functions from compensatory adaptations observed in genetic knockout models . High-throughput screening platforms coupled with rational drug design informed by structural data represent promising approaches to develop these much-needed chemical probes.

Another significant challenge is the efficient expression and purification of functional SLC1 protein in quantities sufficient for structural studies. As a membrane-associated protein, SLC1 presents difficulties in expression, solubilization, and crystallization. Alternative expression systems, including insect cells or mammalian cells, combined with optimized detergent or nanodisc formulations, may overcome these hurdles . Cryo-electron microscopy offers a promising alternative to crystallography for structural determination, potentially requiring less protein and accommodating greater conformational heterogeneity.

For cellular studies, a major challenge is monitoring SLC1 activity in real-time within living cells. Development of fluorescent or bioluminescent reporters that can detect acyltransferase activity or changes in local phospholipid composition would represent a significant advance. Additionally, studying the spatial organization of SLC1 activity requires improved subcellular resolution in lipidomic analyses, potentially achievable through emerging spatial lipidomics techniques.

Translating findings from yeast models to mammalian systems presents another methodological challenge, particularly in understanding tissue-specific roles of SLC1 homologs. Development of conditional knockout models and tissue-specific expression systems will be essential for this transition. Finally, integration of multi-omics data (genomics, transcriptomics, proteomics, lipidomics) remains challenging but necessary for systems-level understanding of SLC1 function. Advanced computational methods, including machine learning approaches, may facilitate this integration and reveal emergent properties not apparent from individual datasets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.