Recombinant Saccharomyces cerevisiae Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Probable endonuclease LCL3 (LCL3) refers to a protein produced using recombinant DNA technology in Saccharomyces cerevisiae (Baker's yeast) that is likely an endonuclease with the systematic name "Probable endonuclease LCL3" . Endonucleases are enzymes that cleave phosphodiester bonds within a nucleic acid molecule, and LCL3 exhibits homology to Staphylococcus aureus nuclease, although its precise function remains largely unknown .

Basic Information

CharacteristicDescription
OrganismSaccharomyces cerevisiae (strain JAY291 or ATCC 204508 / S288c)
Protein TypeRecombinant Protein
Recommended NameProbable endonuclease LCL3
EC Number3.1.-.-
Gene NameLCL3
ORF NameC1Q_04697
UniProt IDP53153
Amino Acid Length274
Molecular WeightApproximately 31.4 kDa (calculated)
Tag InformationVaries depending on the production process (e.g., His-tag)
Storage BufferTris-based buffer with 50% glycerol, optimized for the protein
Storage ConditionsStore at -20°C; for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week .
Amino Acid SequenceMREGDSNSKKSADVAVLSIILTGSTLTLIYTYKRYLTQFKRTNDIPRRIFRKHWLYGKVT SVGDGDNFHFFHMPGGIRGGWGWLRPVPQMIKNDSTAEKLVGDSRNMRFFNFNWITHGRS TKSKIQKAKSQFLKLNVPYKNRKNLPTIPIRLCGIDAPERAHFGNPAQPFGNEALIWLQN RILGKKVWVKPLSIDQYNRCVARVSYWDWFGGWKDLSLEmLKDGLAVVYEGKVNTEFDDR EDKYRYYEFLARSRKKGLWIQNKFETPGEYKKRI

Production and Availability

Recombinant LCL3 is produced in Saccharomyces cerevisiae using recombinant DNA technology . The protein is available for purchase from various commercial sources for research purposes . It is often expressed with an N-terminal His tag to facilitate purification using immobilized metal affinity chromatography (IMAC) .

Biological Role and Function

The LCL3 gene encodes a putative protein of unknown function . Studies suggest that mutants of LCL3 exhibit a long chronological lifespan . LCL3 shows homology to Staphylococcus aureus nuclease, implying a potential role in nucleic acid metabolism .

Endonuclease Activity in Saccharomyces cerevisiae

Saccharomyces cerevisiae possesses several endonucleases involved in DNA repair and replication . For example, Rad27 is a flap endonuclease that cleaves RNA from R-loop structures, which are associated with genomic instability . Additionally, the mismatch repair (MMR) pathway relies on endonucleases like Pms1 to correct errors in newly replicated DNA . Loss of Pms1 endonuclease activity results in a strong mutator effect across the Saccharomyces cerevisiae genome, increasing mutation rates for single-base substitutions and indel mutations . Furthermore, Saccharomyces cerevisiae contains two genes, NTG1 and NTG2, which encode proteins similar to endonuclease III from Escherichia coli, involved in removing oxidized pyrimidine base damage .

Potential Applications

  • Biochemical Assays: Recombinant LCL3 can be used in biochemical assays to determine its substrate specificity, optimal reaction conditions, and catalytic mechanism.

  • Structural Studies: Structural studies, such as X-ray crystallography or NMR spectroscopy, can provide insights into the three-dimensional structure of LCL3 and its interactions with DNA or RNA substrates.

  • Yeast Genetics: Mutants lacking LCL3 can be studied to determine the phenotypic consequences of its absence, providing clues about its cellular role.

  • Synthetic Biology: LCL3 could be employed in synthetic biology applications requiring specific DNA or RNA cleavage activities.

Future Research Directions

  • Functional Characterization: Further research is needed to elucidate the precise biochemical function of LCL3, including its preferred substrates and catalytic activity.

  • Structural Analysis: Determining the crystal structure of LCL3 would provide valuable insights into its active site and substrate binding.

  • In vivo Studies: Investigating the role of LCL3 in DNA repair, replication, or other cellular processes in Saccharomyces cerevisiae would provide a better understanding of its physiological function.

  • Comparative Genomics: Comparing LCL3 to other known nucleases may reveal conserved motifs or domains that are important for its activity.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, special requests can be accommodated. Please specify your format preference when ordering.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LCL3; YGL085W; Probable endonuclease LCL3; Long chronological lifespan protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
LCL3
Target Protein Sequence
MREGDSNSKKSADVAVLSIILTGSTLTLIYTYKRYLTQFKRTNDIPRRIFRKHWLYGKVT SVGDGDNFHFFHMPGGIRGGWGWLRPVPQMIKNDSTAEKLVGDSRNMRFFNFNWITHGRS TKSKIQKAKSQFLKLNVPYKNRKNLPTIPIRLCGIDAPERAHFGNPAQPFGNEALIWLQN RILGKKVWVKPLSIDQYNRCVARVSYWDWFGGWKDLSLEMLKDGLAVVYEGKVNTEFDDR EDKYRYYEFLARSRKKGLWIQNKFETPGEYKKRI
Uniprot No.

Target Background

Database Links

KEGG: sce:YGL085W

STRING: 4932.YGL085W

Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

How conserved is LCL3 across different yeast strains?

Based on the search results, LCL3 appears to be highly conserved across different Saccharomyces cerevisiae strains. The amino acid sequence is identical between strain RM11-1a and strain JAY291, suggesting strong evolutionary conservation . This high degree of conservation indicates the protein likely serves an important biological function. LCL3 homologs also exist in other fungal species, including Phaeosphaeria nodorum, Aspergillus species, Zygosaccharomyces rouxii, Podospora anserina, Ashbya gossypii, and Colletotrichum graminicola, further supporting its evolutionary significance .

What expression systems are optimal for recombinant LCL3 production?

While E. coli is commonly used as the host for recombinant LCL3 expression according to commercial sources , expression in Saccharomyces cerevisiae itself presents certain advantages for this yeast protein. For optimal expression in S. cerevisiae, consider the following methodological approach:

  • Vector selection: For expression in S. cerevisiae, use episomal plasmids (YEp), centromeric plasmids (YCp), or integrative plasmids (YIp) depending on your experimental needs .

  • Promoter choice: The ENO1 promoter has been shown to be effective for recombinant protein expression in S. cerevisiae, as it drives strong constitutive expression .

  • Culture conditions: For maximum biomass and protein yield, utilize respiratory growth conditions rather than fermentative metabolism. This can be achieved using glycerol as a carbon source instead of glucose, which suppresses the Crabtree effect and results in increased volumetric yield of recombinant proteins .

  • Strain selection: Consider using protease-deficient strains if proteolysis is a concern. Also evaluate specialized strains developed for improved protein production based on transcriptional profiling studies .

How can I optimize purification of recombinant LCL3?

For optimal purification of recombinant LCL3, consider the following protocol based on common practices for similar proteins:

  • Buffer selection: Use a Tris-based buffer with 50% glycerol for optimal protein stability, as indicated in the commercial product specifications .

  • Tag strategy: While the tag type may vary depending on the expression system, consider affinity tags like His-tag or GST for simplified purification. The tag selection should be determined during the production process to minimize interference with protein function .

  • Storage conditions: Store the purified protein at -20°C, and for extended storage, consider -80°C. Avoid repeated freezing and thawing cycles. For short-term work, store working aliquots at 4°C for up to one week .

  • Protein stability considerations: Given the endonuclease activity, include appropriate controls to prevent degradation of the protein and any nucleic acids in your experimental system.

How can LCL3 be employed in synthetic recombinant population studies?

LCL3 can be utilized as a marker or reporter in synthetic recombinant population studies in S. cerevisiae. The approach would involve:

  • Tagging methodology: Implement seamless gene tagging of LCL3 using endonuclease-driven homologous recombination. This preserves endogenous gene regulation while allowing tracking of the protein .

  • Population construction: When creating synthetic recombinant populations, a pairwise crossing design (S-type) rather than simple mixing (K-type) maximizes genetic variation, as demonstrated in research with S. cerevisiae . The process would involve:

    a. Pairing haploid strains of opposite mating types
    b. Isolating successful diploid colonies
    c. Inducing sporulation and tetrad dissection
    d. Validating meiotic products and pooling in equal volumes
    e. Allowing mating and selecting for diploid cells

  • Outcrossing cycles: Subject the population to 12 consecutive cycles of outcrossing to ensure genetic diversity, following protocols similar to those described by Burke et al. .

  • Evaluation metrics: Track LCL3 haplotype frequencies via genome sequencing at specific timepoints (initial, after 6 cycles, and after 12 cycles) to understand evolutionary patterns .

What role might LCL3 play in chronological lifespan regulation?

As implied by its name (Long chronological lifespan protein 3), LCL3 may be involved in regulating chronological lifespan in yeast. To investigate this function:

  • Knockout studies: Create LCL3 deletion mutants using CRISPR-Cas9 or traditional homologous recombination techniques to observe effects on chronological lifespan.

  • Overexpression analysis: Develop strains with LCL3 under the control of inducible promoters to evaluate the impact of increased expression on lifespan.

  • Site-directed mutagenesis: Introduce specific mutations in the predicted active site residues to correlate endonuclease activity with lifespan effects.

  • Protein-protein interaction studies: Identify binding partners using techniques like affinity purification coupled with mass spectrometry to elucidate the pathway(s) through which LCL3 influences lifespan.

  • Localization studies: Track the subcellular localization of LCL3 under different growth conditions and stresses to understand its context-dependent functions.

What factors should be considered when designing experiments with recombinant LCL3?

When designing experiments with recombinant LCL3, consider these key factors:

  • Protein stability: Given LCL3's storage requirements (Tris-based buffer with 50% glycerol), design experiments that account for potential stability issues .

  • Enzymatic activity controls: Include appropriate controls to verify and quantify the endonuclease activity, such as known substrate DNA and inhibition controls.

  • Strain background effects: The genetic background of your S. cerevisiae strain can significantly impact protein expression and function. Consider using multiple strain backgrounds when possible .

  • Growth conditions impact: Factor in that different growth conditions (respiratory vs. fermentative) can drastically alter protein expression levels in S. cerevisiae .

  • Glycosylation consideration: Be aware that S. cerevisiae tends to hyperglycosylate N-linked sites, which can affect protein activity. If glycosylation is a concern, consider using P. pastoris as an alternative host with shorter oligosaccharide chains .

How can I develop a robust assay to measure LCL3 endonuclease activity?

To develop a robust assay for LCL3 endonuclease activity:

  • Substrate selection: Start with a panel of different DNA substrates (circular, linear, single-stranded, double-stranded) to determine specificity.

  • Reaction conditions optimization: Systematically test various buffer conditions, pH ranges, salt concentrations, and metal cofactors to identify optimal enzymatic activity conditions.

  • Quantification methods: Implement gel-based assays to visualize cleavage products, as well as fluorescence-based real-time assays using labeled substrates for quantitative measurements.

  • Controls:

    • Positive control: Include a well-characterized endonuclease with known activity

    • Negative control: Heat-inactivated LCL3

    • Specificity control: Non-substrate nucleic acids

  • Kinetic analysis: Determine enzyme kinetics parameters (Km, Vmax) under optimal conditions to characterize the enzymatic properties fully.

How can LCL3 be used in vaccine development research?

Following the model of other recombinant S. cerevisiae applications in vaccine development:

  • Antigen presentation system: LCL3 could potentially be used as a fusion partner for antigens of interest, leveraging the ability of recombinant S. cerevisiae to deliver antigens effectively in vaccine immunotherapy protocols .

  • Dendritic cell activation: When presented in the context of yeast cells, recombinant proteins can activate dendritic cells, elevating MHC class I and II, costimulatory molecules, and inducing Type I inflammatory cytokines .

  • In vivo responses: Test vaccination protocols by measuring antigen-specific CD4+ and CD8+ immune responses similar to protocols used with other recombinant yeast vaccines .

  • Advantage assessment: Evaluate whether the LCL3 fusion provides advantages in terms of stability, immunogenicity, or specific targeting compared to other fusion partners.

What insights can LCL3 provide into DNA repair mechanisms in yeast?

As a probable endonuclease, LCL3 may participate in DNA repair pathways:

  • Pathway identification: Use proteomic approaches to identify which DNA repair pathway(s) LCL3 might participate in—base excision repair, nucleotide excision repair, mismatch repair, or double-strand break repair.

  • Damage response: Assess LCL3 expression and localization changes in response to different DNA-damaging agents (UV, ionizing radiation, chemical mutagens).

  • Interaction partners: Map the interactome of LCL3 specifically in the context of DNA damage response, looking for interactions with known repair factors.

  • Evolutionary conservation: Compare the function of LCL3 to homologous proteins in other fungi and potentially higher eukaryotes to understand conserved repair mechanisms.

  • Clinical relevance: Explore whether insights from LCL3's role in DNA repair might inform understanding of DNA repair defects in human diseases such as cancer.

How can I address low yield issues when expressing recombinant LCL3?

If experiencing low yield of recombinant LCL3, implement these troubleshooting strategies:

  • Optimize codon usage: Adjust codons to match the preferred usage in your expression host, especially if using E. coli rather than S. cerevisiae.

  • Evaluate toxicity: Determine if LCL3 expression is toxic to the host cells by monitoring growth curves and using inducible promoters to control expression timing.

  • Culture conditions optimization: For S. cerevisiae expression, use respiratory conditions by growing in glycerol-containing media instead of glucose to increase biomass and protein yield .

  • Expression optimization table:

ParameterStandard ConditionOptimized ConditionExpected Improvement
MediaYPD (glucose)YPG (glycerol)2-3 fold increase in biomass
Temperature30°C24-27°CImproved protein folding
Induction timeEarly log phaseMid-log phaseIncreased cell density before metabolic burden
Host strainStandard laboratoryProtease-deficientReduced protein degradation
AerationStandard shakingHigh aerationImproved respiratory growth
  • Consider alternative hosts: If expression in S. cerevisiae remains problematic, P. pastoris might be an alternative host, offering high-density growth and potentially lower hyperglycosylation .

What strategies can address protein aggregation or insolubility issues with LCL3?

To address aggregation or insolubility of recombinant LCL3:

  • Expression temperature: Lower the expression temperature to 16-24°C to slow protein production and allow proper folding.

  • Fusion partners: Consider solubility-enhancing fusion partners such as MBP (maltose-binding protein) or SUMO.

  • Buffer optimization: Test various buffer compositions with different pH values, salt concentrations, and additives (glycerol, sorbitol, arginine, detergents) to improve solubility.

  • Refolding protocols: If LCL3 forms inclusion bodies, develop a refolding protocol from denaturing conditions using gradual dialysis or on-column refolding.

  • Co-expression with chaperones: Co-express with molecular chaperones like Hsp70, Hsp90, or the GroEL/ES system to assist proper folding.

What emerging techniques could advance the study of LCL3 function?

Several cutting-edge techniques could significantly advance LCL3 functional studies:

  • Cryo-EM structural analysis: Determine the high-resolution structure of LCL3 to gain insights into its catalytic mechanism and substrate specificity.

  • Single-molecule approaches: Use single-molecule techniques to observe LCL3-DNA interactions in real-time, revealing the dynamics of substrate recognition and processing.

  • In situ labeling technologies: Apply proximity labeling approaches like BioID or APEX to map the LCL3 interactome in living cells under various conditions.

  • Long-read sequencing analysis: Employ long-read sequencing technologies to identify LCL3 cleavage sites genome-wide with high precision.

  • Engineered LCL3 variants: Create protein variants with altered specificity or activity through directed evolution or rational design for specialized applications.

How might systems biology approaches provide new insights into LCL3 function?

Integrative systems biology approaches could reveal broader contexts for LCL3 function:

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data from LCL3 mutants to construct comprehensive pathway maps affected by LCL3 activity.

  • Network analysis: Apply protein-protein interaction network analysis to position LCL3 within the broader cellular machinery for DNA processing and lifespan regulation.

  • Synthetic genetic array (SGA) analysis: Perform systematic genetic interaction screens to identify genes that buffer or exacerbate LCL3 deletion phenotypes, revealing functional relationships .

  • Computational modeling: Develop mathematical models of DNA damage response incorporating LCL3 activity to predict system-level behaviors under various stress conditions.

  • Evolutionary systems biology: Compare LCL3 function across fungal species to understand how its role has evolved and how it integrates into different cellular networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.