Recombinant Saccharomyces cerevisiae Probable GDP-mannose transporter 2 (HVG1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene and Protein Details

  • Gene Name: HVG1 (synonyms: YEM9, GMT2, EC1118_1E8_1442g) .

  • Protein: Probable GDP-mannose transporter 2 (UniProt ID: C8Z742) .

  • Structure: A transmembrane protein with a lysine-rich C-terminal tail critical for Golgi localization via interaction with COPI coat proteins (e.g., Ret2p) .

Recombinant Production

  • Host Systems: Expressed in E. coli, yeast (e.g., S. cerevisiae), baculovirus, or mammalian cells .

  • Purity: >90% for commercial variants .

  • Storage: Stable at -20°C or -80°C in glycerol-containing solutions .

Recombinant VariantsHostTagLengthSource
Full-length HVG1 (1-249 aa)E. coliHis-tag249 aaCreative BioMart
Partial HVG1 (unstructured regions)YeastNoneN/AMyBiosource

Functional Role in GDP-Mannose Transport

HVG1 ensures efficient GDP-mannose import into the Golgi lumen, a prerequisite for:

  • Protein Mannosylation: Post-translational modification of secretory proteins .

  • Sphingolipid Synthesis: Production of mannose-containing sphingolipids .

Key Findings

  • Transport Efficiency: gda1 null mutants (defective in GDPase activity) exhibit a 5-fold reduction in GDP-mannose uptake into Golgi vesicles, impairing mannosylation .

  • Localization Mechanism: The C-terminal lysine cluster binds COPI components (e.g., Ret2p), preventing vacuolar degradation and enabling Golgi retention .

Applications in Research

  • Glycosylation Studies: Used to investigate mannosylation defects in S. cerevisiae mutants .

  • Bioreactor Engineering: Recombinant HVG1 supports metabolic engineering of yeast for biofuel production (e.g., xylose fermentation) by maintaining glycosylation efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
HVG1; YEM9; SCRG_04508; Probable GDP-mannose transporter 2; GMT 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Target Names
HVG1
Target Protein Sequence
MIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTSMELTSFIMMVLSSVVATW GDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISSALFVLIMRKRIRLTNFKD YDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADSLAAMVISGLMSVGISYCSGWCV RVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFSIFLGFLSGLLYAVAKQKKIQQQ KVLAATLEK
Uniprot No.

Target Background

Function
This protein plays a crucial role in the import of GDP-mannose from the cytoplasm into the Golgi lumen.
Protein Families
TPT transporter family, SLC35D subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of GDP-mannose transporters in yeast cells?

GDP-mannose transporters (GMTs) serve a critical function in eukaryotic glycosylation pathways by transporting GDP-mannose from the cytosol, where it is synthesized, to the Golgi lumen prior to mannosylation processes. Within the Golgi, mannose attaches to modified proteins as part of essential glycosylation reactions. This transport step is necessary because all GDP sugars are biosynthesized in the cytosol but require transport into the Golgi or ER lumen to be made available for glycosylation reactions . The importance of these transporters is underscored by the fact that disruption of any step in GDP-mannose biosynthesis or transport can significantly affect fungal viability, growth, or virulence .

How does HVG1 relate to other characterized GDP-mannose transporters?

HVG1 in S. cerevisiae is paralogous to the well-characterized VRG4 GDP-mannose transporter. Functional analysis shows similarity to the GONST family of transporters from plants, particularly GONST1 from Arabidopsis, which can functionally complement the yeast vanadate resistance glycosylation (vrg4-2) GDP-Man transporter mutant . While GONST1 has been shown to transport multiple GDP sugars in vitro with varying affinities (apparent Km of 17 μM for GDP-Man and 76 μM for GDP-Fuc), HVG1's substrate specificity profile requires further characterization . Understanding these relationships helps position HVG1 within the broader context of nucleotide sugar transporter evolution.

What experimental systems are most suitable for initial characterization of HVG1?

For initial characterization of HVG1, researchers should consider:

  • Yeast knockout complementation systems: Utilizing vrg4 mutant strains allows assessment of HVG1's ability to rescue growth defects, similar to studies with GONST1 .

  • Recombinant expression systems: Expression of HVG1 in various hosts (yeast, bacteria, insect cells) followed by reconstitution into proteoliposomes for in vitro transport assays.

  • Subcellular localization studies: Fluorescent protein tagging to confirm Golgi localization, which is essential for understanding the protein's native function.

  • Phenotypic analysis: Examining growth characteristics, cell wall composition, and glycoprotein patterns in strains with HVG1 deletion or overexpression.

These approaches provide a foundation for more sophisticated analyses of transporter function and specificity.

What methodologies are most effective for determining the substrate specificity of HVG1?

Determining substrate specificity of HVG1 requires a multi-faceted approach:

In vitro transporter assays: The most direct method involves reconstituting the purified transporter into proteoliposomes pre-loaded with exchange substrates (typically GMP based on studies of similar transporters) . The proteoliposomes are then incubated with a mixture of potential nucleotide sugar substrates, and transport is measured using LC-MS/MS analysis.

Table 1: Example protocol for in vitro transport assay of GDP-mannose transporters

StepProcedureCritical Parameters
1Expression of HVG1 in yeastOptimal strain selection, induction conditions
2Preparation of microsomal fractionsBuffer composition, prevention of proteolysis
3Reconstitution into liposomesLipid composition, protein:lipid ratio
4Pre-loading with exchange substrateTypically GMP at 10mM concentration
5Incubation with nucleotide sugar mixture16 common nucleotide sugars at equal concentrations
6Removal of non-incorporated substratesGel filtration or other separation technique
7Analysis by LC-MS/MSSensitive quantification of incorporated substrates

Kinetic analysis: Determining saturation kinetics by varying substrate concentration and measuring initial transport rates allows calculation of parameters such as Km and Vmax. Based on studies of related transporters, researchers should examine whether HVG1 transport is saturable in a concentration- and time-dependent manner .

Competition assays: Using a fixed concentration of a confirmed substrate with varying concentrations of potential competing substrates can reveal relative affinities and transport preferences.

How can researchers effectively analyze the impact of HVG1 mutations on cellular glycobiology?

Analyzing the impact of HVG1 mutations requires systematic approaches:

  • Site-directed mutagenesis strategy: Target conserved residues identified through sequence alignment with characterized transporters like VRG4 and GONST1.

  • Complementation analysis: Test whether mutated versions of HVG1 can rescue phenotypes in deletion strains.

  • Glycomic profiling: Employ mass spectrometry to comprehensively analyze changes in cell wall mannosylation, protein glycosylation, and glycolipid composition.

  • Cell wall integrity assays: Assess sensitivity to cell wall-perturbing agents (e.g., Calcofluor White, Congo Red) as indicators of altered mannose incorporation into cell wall components.

  • Protein trafficking analysis: Examine effects on the transport and localization of known mannosylated proteins.

This multi-layered approach allows researchers to connect specific HVG1 mutations to broader cellular phenotypes and molecular functions.

What synergistic effects might be achieved by manipulating HVG1 expression alongside other secretory pathway components?

Researchers investigating synergistic effects should consider:

Recent studies of secretory pathway optimization in S. cerevisiae have demonstrated that combining gene deletions with gene overexpressions can yield significant improvements in protein expression. For example, simultaneously deleting YPT32 (involved in intra-Golgi trafficking) and overexpressing IRE1 (a key regulator of the unfolded protein response) led to a 2.12-fold increase in recombinant protein expression over wild-type strains .

A systematic approach to identifying synergistic effects with HVG1 would include:

  • Screening for genetic interactions: Utilize synthetic genetic array (SGA) analysis to identify genes that genetically interact with HVG1.

  • Combinatorial perturbations: Test combinations of HVG1 overexpression or deletion with modifications of other secretory pathway genes, particularly those involved in:

    • ER-associated degradation

    • Protein folding

    • Unfolded protein response (UPR)

    • Vesicular trafficking

  • Measurement of combinatorial effects: Assess impacts on:

    • Glycoprotein quality and quantity

    • Cell growth and viability

    • Stress response activation

    • Secretion efficiency

This systematic optimization approach is particularly valuable when developing S. cerevisiae strains for recombinant protein production.

What are the optimal conditions for expressing recombinant HVG1 for functional studies?

The expression of recombinant HVG1 requires careful optimization:

Vector selection: For studies in S. cerevisiae, considerations include:

  • Promoter strength (constitutive GAL1 vs. inducible)

  • Copy number (CEN/ARS vs. 2μ vectors)

  • Selection markers compatible with strain backgrounds

Expression conditions:

  • Temperature: Typically 25-30°C, with lower temperatures potentially improving proper folding

  • Induction timing: Mid-log phase typically yields optimal expression

  • Media composition: Supplementation with additional mannose can support glycosylation machinery

Protein tagging strategies:

  • C-terminal tagging is generally preferred to avoid interfering with N-terminal targeting sequences

  • Common epitope tags (HA, FLAG, His6) or fluorescent protein fusions

  • Verification of functionality after tagging is essential

Verification methods:

  • Western blotting to confirm expression

  • Subcellular fractionation to verify Golgi localization

  • Complementation assays to confirm functionality

These optimizations help ensure that the recombinant HVG1 being studied retains its native functionality and localization.

How can researchers effectively measure the transport activity of HVG1 in vivo?

Measuring in vivo transport activity presents unique challenges due to the intracellular location of HVG1 and the complexity of cellular metabolism. Effective approaches include:

  • Genetic complementation assays: Measuring the ability of HVG1 to rescue growth or glycosylation defects in vrg4 mutants provides indirect evidence of transport activity.

  • Metabolic labeling: Using radioactively labeled mannose precursors to track incorporation into glycoproteins and glycolipids.

  • Analysis of mannose-containing structures: Examining alterations in mannan structure, GPI-anchored proteins, and N-linked glycans.

  • Reporter systems: Development of mannose-dependent reporter proteins whose localization, stability, or activity depends on proper mannosylation.

  • Organelle isolation: Isolation of Golgi-enriched fractions to measure GDP-mannose uptake in a more controlled but still cellular context.

These approaches connect HVG1 activity to downstream biological effects, providing a more comprehensive view of its function than in vitro assays alone.

What are common challenges in purifying active HVG1 for in vitro studies, and how can they be addressed?

Purifying active membrane transporters like HVG1 presents several challenges:

Table 2: Common challenges and solutions in HVG1 purification

ChallengeManifestationSolution Approach
Low expression levelsWeak bands on Western blotsOptimize codon usage; use strong inducible promoters; consider specialized expression hosts
Protein misfoldingAggregation during extractionLower expression temperature (16-20°C); use mild detergents; add stabilizing agents
Detergent selectionLoss of activity during solubilizationScreen multiple detergents (DDM, LMNG, CHAPS); consider novel amphipols or nanodiscs
Protein stabilityActivity loss during purificationInclude glycerol (10-15%) and reducing agents; minimize purification time
Reconstitution efficiencyPoor incorporation into liposomesOptimize protein:lipid ratios; try different lipid compositions; use controlled dehydration-rehydration

An important consideration is verification of protein functionality after each purification step. This can be achieved through binding assays with fluorescently labeled GDP-mannose analogs or small-scale transport assays using the reconstitution protocol mentioned in question 2.1.

How can researchers resolve contradictory findings about HVG1 substrate specificity?

When facing contradictory findings about HVG1 substrate specificity, researchers should:

  • Standardize experimental conditions: Minor differences in pH, temperature, membrane composition, or protein orientation can significantly impact transporter behavior. Establishing standardized protocols facilitates direct comparison between studies.

  • Consider post-translational modifications: Differences in glycosylation or phosphorylation status between expression systems may affect substrate binding and transport.

  • Examine protein purity and integrity: Western blotting with N- and C-terminal specific antibodies can verify that the full-length protein is being studied.

  • Cross-validate using multiple techniques:

    • In vitro transport assays

    • Substrate binding studies

    • In vivo complementation

    • Structural analyses

  • Investigate potential regulatory factors: Some transporters show altered specificity in response to regulatory proteins or lipid environment.

By systematically addressing these factors, researchers can reconcile seemingly contradictory findings and develop a more nuanced understanding of HVG1 substrate specificity.

What statistical approaches are most appropriate for analyzing HVG1 kinetic data?

Analyzing kinetic data for membrane transporters requires specialized statistical approaches:

  • Model selection for kinetic parameters:

    • Standard Michaelis-Menten equations for simple transport

    • Hill equations when cooperativity is suspected

    • Competitive, non-competitive, or mixed inhibition models for multi-substrate studies

  • Robust regression methods: Due to the inherent variability in membrane protein assays, robust regression methods that are less sensitive to outliers are often preferable to standard least-squares regression.

  • Global fitting approaches: When examining multiple substrates or conditions, simultaneously fitting all data to a shared model can provide more reliable parameter estimates.

  • Bootstrap resampling: To establish confidence intervals for kinetic parameters without assuming normal distribution of errors.

  • Statistical comparison of transport models: Using Akaike Information Criterion (AIC) or F-tests to determine whether more complex models of transport (e.g., those involving multiple binding sites) are statistically justified.

Based on studies of related transporters like GONST1, researchers should expect saturable kinetics with Km values typically in the micromolar range for preferred substrates .

How can HVG1 be leveraged for improved recombinant protein production in S. cerevisiae?

Leveraging HVG1 for improved protein production builds on understanding its role in glycosylation pathways:

  • Engineered HVG1 variants: Creating variants with altered substrate specificity or improved transport efficiency could enhance glycosylation of recombinant proteins.

  • Balanced expression: Careful titration of HVG1 expression levels, as both insufficient and excessive GDP-mannose transport may impact glycoprotein quality.

  • Synergistic genetic modifications: Combining HVG1 manipulation with modifications to other secretory pathway components. For example, the approach used for HBsAg expression improvement through deletion of YPT32 combined with IRE1 overexpression could be adapted to include HVG1 modifications .

  • Pathway engineering: Coordinating HVG1 expression with enzymes involved in GDP-mannose synthesis and mannosyltransferases.

  • Strain-specific optimization: Different S. cerevisiae strain backgrounds may require different HVG1 expression strategies for optimal results.

This multi-faceted approach recognizes the interconnected nature of glycosylation pathways and the need for balanced interventions.

What techniques can be used to examine the structural dynamics of HVG1 during substrate transport?

Examining structural dynamics of membrane transporters during transport cycles remains challenging but several cutting-edge approaches can provide valuable insights:

  • Cysteine accessibility methods: Introducing cysteine residues at key positions and measuring their accessibility to membrane-impermeant reagents can reveal conformational changes during transport.

  • Site-directed fluorescence spectroscopy: Attaching environmentally sensitive fluorophores to specific residues allows real-time monitoring of protein conformational changes.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): This technique can identify regions of the protein that undergo structural changes upon substrate binding.

  • Single-molecule FRET: By labeling different domains with donor and acceptor fluorophores, researchers can monitor distance changes during the transport cycle.

  • Cryo-EM: Recent advances in cryo-electron microscopy make it increasingly feasible to capture transporters in different conformational states.

  • Molecular dynamics simulations: Computational approaches can model the dynamic behavior of HVG1 in a lipid bilayer environment, generating testable hypotheses about the transport mechanism.

These approaches complement each other and, when combined, can provide comprehensive insights into how HVG1 accomplishes GDP-mannose transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.