Recombinant Saccharomyces cerevisiae Probable metalloreductase AIM14 (AIM14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM14; SCY_1908; Probable metalloreductase AIM14; Altered inheritance of mitochondria protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-570
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
AIM14
Target Protein Sequence
MKESPLITLVKRHSETHFANIKYGYYVLIISLVYLIGLALLRAFGRRTPSRSSSAFKNKI IYRLYDIDPAIHLGILFFAVLIPFYYHYSLTTQSTVYLKRLGRLSYALIPLNLFLTLRPN WFLRKNCTYTDFIPFHKWFSRIITVIGLLHGIFFIIKWAIDDNVSLKQKLILKTFNFVGF IISILVLFLLICSIGPMRRYNYRLFYIVHNLVNVAFILLTPIHSRPGVKFPFLLLNCTLL FIHIINRIVFAKSLMILNKNANYSKTNLVHVRLPRAILPDYFEPGSHIRISPYRRINPLY WLLPSHPYTIASLAEDNSIDLIIKETSTAEPGSQIESLRSNPKSFHLDQEKTYTLINSYP PSVPEECYSQGTNIAIICGGSGISFALPLFRHFFNKENVKYLKMIWLIKNYSEYELVLDY LKTNGLTFEKKLSNNKRISVFISGEYTAETRLDEITTNIDDENSEYEMGSFNNEDEDLSI SNFNSENADSNDNTPETSHSPTKENGSLIEVKSKHSFTLSNELKSFNNESAQVNQNETWL FSCGPPSLLQLSKKYCNDERINFVCETYGL
Uniprot No.

Target Background

Function

Probable Function: Cell surface metalloreductase potentially involved in iron or copper homeostasis.

Protein Families
Ferric reductase (FRE) family, AIM14 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is AIM14 and what are its alternative designations in scientific literature?

AIM14 (Altered Inheritance of Mitochondria protein 14) is also known as YNO1 or is encoded by the gene YGL160W in Saccharomyces cerevisiae. It functions as a NADPH oxidase ortholog and has been identified as a probable metalloreductase. The protein plays a significant role in redox processes within yeast cells, as evidenced by increased superoxide levels upon its overexpression . The full protein consists of 570 amino acids and is involved in several cellular functions related to oxidative metabolism.

What are the optimal storage and reconstitution conditions for recombinant AIM14?

Recombinant AIM14 protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. For long-term storage, the following protocol is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard)

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

The reconstituted protein is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain stability .

How can AIM14 be effectively overexpressed in yeast systems for functional studies?

For effective overexpression of AIM14 in yeast systems, researchers have successfully employed several expression vectors and protocols:

Table 1: Expression Systems for AIM14/YNO1

Expression VectorPromoter TypeInduction MethodExpression LevelReference
pCM297Doxycycline-inducible100 mg/L doxycyclineModerate
pYES2GAL1 (galactose-inducible)3% galactoseHigh

For optimal experimental design:

  • Select an expression system based on your experimental needs (moderate expression with tight regulation using pCM297 or high expression using pYES2)

  • Transform the construct into appropriate yeast strains (BY4741 has been successfully used)

  • Grow cultures to mid-exponential phase before induction

  • For doxycycline-inducible systems, measure activity at multiple time points (e.g., 6 and 16 hours post-induction)

  • For GAL1 promoter systems, ensure complete media change from glucose to galactose-containing media

This methodology allows for controlled expression studies to examine AIM14's function in various cellular contexts.

What assays are appropriate for measuring AIM14 activity in yeast cells?

Given AIM14/YNO1's function as a NADPH oxidase that generates superoxide, the following assays are appropriate for measuring its activity:

  • Dihydroethidium (DHE) assay: This is the primary method used to detect superoxide production. When overexpressing YNO1 in the BY4741 strain, a 50% increase in DHE oxidation has been observed compared to control strains carrying empty vectors .

  • Growth phenotype analysis: Overexpression of YNO1 causes a significant increase in the proportion of budded cells in stationary phase, providing an indirect measure of AIM14 activity's effect on cell cycle .

  • Cytoskeletal visualization: Using genomic integration of ABP140-eGFP in SEY strain backgrounds, researchers can visualize effects on the actin cytoskeleton following AIM14 manipulation. This can be coupled with Latrunculin B treatment (20 μM) to assess interactions with cytoskeletal dynamics .

For quantitative assessment, fluorescence spectroscopy or microscopy techniques should be employed with appropriate controls, including the empty vector and known NADPH oxidase positive controls (such as PaNOX1).

How does AIM14/YNO1 interact with other cellular components in the redox network of yeast?

AIM14/YNO1 functions within a complex network of redox-active proteins in yeast. Unlike other ferric/cupric reductases (FRE family proteins), AIM14 produces superoxide in a manner similar to mammalian NADPH oxidases. When investigating its interactions:

  • Consider potential functional overlap with FRE1, FRE3, and FRE8, which have been experimentally compared but show distinct activity profiles

  • Examine its role in redox-dependent cellular processes, as overexpression causes phenotypes consistent with altered redox status

  • Investigate physical and genetic interactions through approaches such as:

    • Co-immunoprecipitation with tagged AIM14

    • Synthetic genetic array (SGA) analysis similar to approaches used for other yeast proteins

    • Mass spectrometry to identify interacting partners

A comprehensive interaction study would provide valuable insights into AIM14's role in cellular redox homeostasis and potentially reveal novel functions beyond currently known activities.

What are the methodological challenges in purifying functional recombinant AIM14 for in vitro studies?

Purification of functional recombinant AIM14 presents several challenges that researchers should address:

  • Membrane protein solubilization: As AIM14 contains transmembrane domains, selection of appropriate detergents is critical. Consider a screening approach with detergents like DDM, CHAPS, or Triton X-100 at varying concentrations.

  • Maintaining redox cofactors: Since AIM14 functions as an oxidoreductase, preserving its cofactor binding capacity is essential. Include appropriate cofactors (NADPH) in purification buffers.

  • Protein stability: The presence of 6% trehalose in storage buffers suggests stability issues. Monitor protein aggregation during purification using dynamic light scattering.

  • Activity preservation: Design activity assays that can be performed at each purification step to track retention of enzymatic function.

  • Expression system selection: While E. coli expression has been reported , consider yeast-based expression systems for proper post-translational modifications.

A systematic approach comparing different purification strategies should be employed, documenting yield, purity, and activity retention at each step to optimize the protocol.

How can genetic interaction screens be designed to identify pathways affected by AIM14/YNO1?

Genetic interaction screens can provide valuable insights into AIM14's functional pathways. Based on methodologies applied to other yeast proteins:

  • Synthetic Genetic Array (SGA) analysis: Construct query strains containing either complete deletion (aim14Δ) or catalytically inactive (aim14-K318A) alleles. Cross these with:

    • The yeast single-gene deletion collection

    • Temperature-sensitive (TS) allele collection

  • Quantification approaches:

    • Score interactions based on colony size deviations from expected growth

    • Identify both negative (synthetic sick/lethal) and positive (epistatic/suppression) interactions

  • Validation of top hits:

    • Confirm phenotypes by random spore analysis

    • Perform spot dilution assays comparing single and double mutants

    • Conduct growth curve analyses of resistant spore clones compared to parental single-mutant strains and wild-type

  • Pathway analysis:

    • Group interacting genes by function (GO terms)

    • Identify enriched pathways and cellular processes

    • Map physical interactions to complement genetic data

This approach has successfully revealed unexpected roles for other yeast proteins, such as Hrq1's involvement in transcription regulation , and could similarly uncover novel functions for AIM14.

What are common pitfalls in working with recombinant AIM14 and how can they be addressed?

Table 2: Common Challenges and Solutions for AIM14 Research

ChallengePossible CausesSolutions
Low protein yieldToxicity to expression hostUse tightly regulated promoters (e.g., doxycycline-inducible system)
Protein degradationAdd protease inhibitors; optimize harvesting time
Loss of activity upon storageFreeze-thaw damageAliquot properly; avoid repeated freeze-thaw cycles
Cofactor lossReconstitute in buffer containing relevant cofactors
Inconsistent activity measurementsVariable expression levelsNormalize to protein concentration; use internal controls
Oxidase auto-inactivationPerform assays immediately after induction/preparation
Poor solubilityTransmembrane domainsUse appropriate detergents; consider membrane fraction preparations

When troubleshooting experiments with AIM14, systematically analyze each step of your workflow, and document all conditions and variations to identify optimal parameters for your specific experimental system.

How can researchers distinguish between direct and indirect effects when studying AIM14's role in oxidative stress?

Distinguishing between direct and indirect effects of AIM14 in oxidative stress requires thoughtful experimental design:

  • Use catalytically inactive mutants: Compare phenotypes between aim14Δ and catalytically inactive mutants (e.g., aim14-K318A) to distinguish between enzymatic and structural functions .

  • Temporal analysis: Monitor superoxide production immediately following induction using time-course experiments with DHE assays.

  • Compartment-specific measurements: Use organelle-targeted oxidative stress sensors to determine where ROS accumulation occurs first.

  • Transcriptional profiling:

    • Compare gene expression changes between wild-type and aim14 mutants

    • Focus on genes known to respond to oxidative stress

    • Look for patterns consistent with direct vs. indirect responses

  • Biochemical validation:

    • Perform in vitro assays with purified components

    • Test direct oxidation of putative targets

    • Use separation techniques to identify direct binding partners

  • Genetic epistasis analysis:

    • Create double mutants with other oxidative stress pathway components

    • Determine whether phenotypes are additive or epistatic

By combining these approaches, researchers can build a comprehensive model distinguishing primary from secondary effects of AIM14 activity.

What statistical approaches are most appropriate for analyzing data from AIM14 functional studies?

For rigorous analysis of AIM14 functional studies, consider the following statistical approaches:

  • For DHE assay data:

    • Normalize fluorescence readings to cell density

    • Use paired t-tests or ANOVA with post-hoc tests for comparing multiple conditions

    • Present data as fold-change relative to control with standard deviation

  • For growth phenotype analysis:

    • Apply area under curve (AUC) calculations for growth curves

    • Use non-parametric tests if data doesn't meet normality assumptions

    • Consider repeated measures ANOVA for time-course experiments

  • For genetic interaction screens:

    • Calculate SGA scores that quantify the deviation of observed growth from expected growth

    • Apply appropriate cutoffs (typically ±2-3 standard deviations from mean) to identify significant interactions

    • Perform false discovery rate (FDR) correction for multiple hypothesis testing

  • For transcriptomic data:

    • Use differential expression analysis tools (DESeq2, edgeR)

    • Apply gene set enrichment analysis (GSEA) to identify affected pathways

    • Validate key findings with RT-qPCR

  • Replication requirements:

    • Perform at least three biological replicates

    • Include technical replicates to assess measurement variation

    • Report both p-values and effect sizes when presenting results

How might AIM14's functions intersect with other cellular processes beyond currently established roles?

Based on current knowledge and analogies to similar proteins, several promising research directions for AIM14 include:

  • Cell cycle regulation: The observation that YNO1 overexpression increases budded cells in stationary phase suggests a potential role in cell cycle control. Investigating interactions with cell cycle checkpoints could reveal novel regulatory mechanisms .

  • Stress response pathways: Beyond oxidative stress, AIM14 may function in other stress response pathways. Systematic testing of aim14 mutants under various stress conditions (osmotic, temperature, pH) could uncover additional functions.

  • Metabolic regulation: As a redox-active enzyme, AIM14 likely influences metabolic pathways. Metabolomics approaches comparing wild-type and mutant strains could reveal affected pathways.

  • Protein quality control: Recent studies with other yeast proteins have revealed unexpected connections to protein quality control systems. AIM14 might play a role in redox-dependent protein folding or degradation.

  • Transcriptional regulation: Similar to findings with the Hrq1 helicase in yeast , AIM14 might influence gene expression patterns. RNA-seq analysis of aim14 mutants could reveal transcriptional effects.

Integrative approaches combining multiple omics technologies would be particularly powerful for mapping these potential new functions of AIM14.

What comparative analyses between AIM14 and mammalian NADPH oxidases might reveal about conserved functions?

Comparative analyses between AIM14/YNO1 and mammalian NADPH oxidases (NOX family) would significantly advance our understanding of these enzymes:

  • Structural comparisons:

    • Align conserved domains and catalytic sites

    • Model substrate binding pockets

    • Compare transmembrane topology and membrane association

  • Functional complementation experiments:

    • Express mammalian NOX proteins in aim14Δ yeast

    • Test if human NOX can rescue yeast phenotypes

    • Express AIM14 in mammalian cell lines with NOX knockdowns

  • Regulatory mechanism comparison:

    • Identify conserved regulatory subunits or interacting partners

    • Compare activation stimuli across species

    • Analyze post-translational modification sites

  • Inhibitor cross-reactivity studies:

    • Test whether known NOX inhibitors affect AIM14 activity

    • Develop parallel screening approaches for inhibitor discovery

    • Use mutational analysis to validate conserved inhibitor binding sites

This comparative approach could identify fundamental mechanisms conserved across evolution while highlighting species-specific adaptations in redox regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.