Recombinant Saccharomyces cerevisiae Processing of GAS1 and ALP protein 2 (PGA2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
PGA2; YNL149C; N1774; Processing of GAS1 and ALP protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-129
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PGA2
Target Protein Sequence
SEVAETWVDTWMAKLVNYDYKHFIRLVIIVGGYLLLRNIASRELAKKQLAAQVEKDKRDK EEKRSKDLIDKPDDAATAETTSFGWGKKTRRRVKRQQELFENALEEAKRRNQGLDPDSDA DIEELLEE
Uniprot No.

Target Background

Function

Involved in the processing and trafficking of GAS1 and PHO8 glycosylated proteins.

Database Links

KEGG: sce:YNL149C

STRING: 4932.YNL149C

Protein Families
PGA2 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein.

Q&A

What is PGA2 and what is its role in S. cerevisiae?

PGA2 (Processing of GAS1 and ALP protein 2) is a transmembrane protein located in the nuclear envelope and nuclear membrane of Saccharomyces cerevisiae. It consists of 129 amino acids and plays a critical role in the processing and trafficking of glycosylated proteins, particularly GAS1 and PHO8 (alkaline phosphatase) . PGA2 functions within the secretory pathway to ensure proper maturation of these glycoproteins as they progress through the endoplasmic reticulum and Golgi apparatus toward their final destinations.

Research methodologies to study PGA2 function typically involve gene knockout studies, protein localization experiments using fluorescent tags, and phenotypic analysis of resulting mutants. Researchers should consider using complementation assays with wild-type PGA2 to confirm the specificity of observed phenotypes when designing experiments to investigate its function.

How does S. cerevisiae process GAS1 proteins?

The GAS1 protein in S. cerevisiae undergoes a complex processing pathway that involves several distinct steps:

  • Initial synthesis as a precursor with a hydrophobic extension at the carboxyl terminus

  • Removal of this extension

  • Replacement with an inositol-containing glycolipid

  • Anchoring to the plasma membrane via this glycolipid

The anchor attachment occurs at Asn506, which serves as the most efficient attachment site for the glycosylphosphatidylinositol (GPI) anchor. This process is highly selective, with only certain amino acids with small side chains being able to function as substrates for peptide cleavage and glycolipid addition. The efficiency hierarchy for anchor attachment sites is: Asn > Ser > Gly > Ala > Asp > Cys . Additionally, the two amino acids immediately adjacent to the carboxyl side of the anchor attachment site significantly impact anchoring efficiency, with shorter side chains being preferred, particularly at the second position .

When investigating GAS1 processing experimentally, researchers should consider using site-directed mutagenesis of the anchor attachment site and surrounding regions, followed by analysis of protein localization and function.

What analytical techniques are essential for studying GAS1 and PGA2 interactions?

Researchers investigating GAS1 and PGA2 interactions should employ multiple complementary techniques:

  • Mutagenesis studies: Saturation mutagenesis of key residues (such as the Asn506 anchor attachment site in GAS1) helps identify critical amino acids for protein-protein interactions and functional processing .

  • Subcellular fractionation: This technique separates cellular components to track protein trafficking through various compartments, essential for understanding how PGA2 influences GAS1 movement through the secretory pathway.

  • Immunoprecipitation: Co-immunoprecipitation experiments can detect physical interactions between PGA2 and GAS1 or processing intermediates.

  • Western blotting: Detection of different GAS1 forms (precursor vs. mature) using antibodies against the protein itself or epitope tags (such as His-tags) can reveal processing status .

  • Fluorescence microscopy: Tagging GAS1 with fluorescent proteins allows visualization of its localization in wild-type versus PGA2-mutant cells.

For optimal results, researchers should incorporate controls for specificity, including comparison with other GPI-anchored proteins that do not depend on PGA2 for processing.

What is the structure-function relationship in GAS1 protein processing?

The structure-function relationship in GAS1 processing reveals several critical features:

  • Anchor attachment site: The Asn506 residue serves as the primary attachment point for the GPI anchor, with its small side chain being crucial for enzyme recognition .

  • Flanking residues: The two amino acids adjacent to the carboxyl side of the anchor attachment site significantly affect anchoring efficiency, with short side chains being optimal and the second position being particularly critical .

  • Spacer region: The region between the anchor attachment site and the carboxyl-terminal hydrophobic domain is not merely a passive spacer but plays an active role in proper processing. Mutations in this region can affect GAS1 processing efficiency, suggesting specific structural requirements beyond simple spacing .

  • Carboxyl-terminal hydrophobic domain: This region is cleaved during processing but is essential for initial recognition by the processing machinery.

This structure-function relationship provides a framework for designing experiments to investigate how mutations might affect GAS1 processing and function. Researchers should consider creating targeted mutations in these key regions when studying the effects on protein trafficking and cellular localization.

How can researchers optimize recombinant protein expression systems for studying GAS1 and PGA2?

Optimization of recombinant protein expression systems for studying GAS1 and PGA2 requires careful consideration of several key factors:

  • Promoter selection: Use of constitutive promoters like GAPDH can provide consistent expression, while inducible promoters allow for temporal control. For GAS1 studies, researchers have successfully used constitutive promoters to achieve reliable expression levels .

  • Vector design: For surface display of GAS1, researchers can utilize fusion with anchor proteins such as Aga2, which has been shown to effectively display proteins on the yeast cell surface . A typical expression cassette might include:

    • A strong promoter (GAPDH)

    • The Aga2 anchor sequence (207 bp)

    • The target gene (GAS1)

    • A terminator sequence (e.g., ADH1 terminator)

  • Codon optimization: Adapting the coding sequence to the preferred codon usage of S. cerevisiae significantly improves expression levels. This approach has been successfully applied for heterologous proteins and should be considered for GAS1 variants .

  • Host strain selection: Different S. cerevisiae strains exhibit varying capabilities for recombinant protein production. The choice between laboratory strains (e.g., S288C) and industrial strains should be guided by specific research needs.

  • Culture conditions: Growth parameters significantly impact recombinant protein production. For optimal expression, researchers should maintain cultures at 30°C with shaking at 180 rpm in appropriate media (YPD for general growth or selective media for maintaining plasmid selection) .

What methodologies are most effective for analyzing GAS1 trafficking in yeast?

Analyzing GAS1 trafficking in yeast requires a multi-faceted methodological approach:

  • Protein extraction and Western blotting: This technique allows detection of different GAS1 forms (precursor vs. mature) based on molecular weight differences. Researchers should:

    • Harvest yeast cells from liquid cultures

    • Lyse cells to obtain protein extracts

    • Separate proteins using SDS-PAGE (typically 12% gels)

    • Transfer to membranes for antibody detection

    • Use specific antibodies (anti-GAS1 or epitope tags like His-tag)

  • Subcellular fractionation: This approach separates cellular compartments (plasma membrane, ER, Golgi) to track the progression of GAS1 through the secretory pathway. Density gradient centrifugation can effectively separate these compartments.

  • Fluorescence microscopy: Tagging GAS1 with fluorescent proteins (GFP variants) allows real-time visualization of trafficking. Co-localization with compartment markers (ER, Golgi, plasma membrane) provides spatial information.

  • Pulse-chase experiments: This technique tracks newly synthesized GAS1 proteins through the secretory pathway by:

    • Briefly exposing cells to radiolabeled amino acids (pulse)

    • Following with non-labeled media (chase)

    • Sampling at different time points to monitor processing

  • Genetic approaches: Creating strains with mutations in trafficking components allows assessment of their impact on GAS1 processing. PGA2 knockout strains are particularly valuable for understanding its specific role.

How do mutations in the anchor attachment site affect GAS1 function?

Mutations in the GAS1 anchor attachment site (Asn506) significantly impact protein processing and function in a predictable hierarchy:

  • Amino acid substitution effects: Saturation mutagenesis studies have revealed that only amino acids with small side chains can function as GPI anchor attachment sites. The efficiency ranking is: Asn > Ser > Gly > Ala > Asp > Cys .

  • Structural consequences: Mutations that introduce amino acids with larger side chains prevent proper recognition by the transamidase complex that mediates GPI anchor attachment.

  • Localization changes: Failed GPI anchor attachment results in retention within the ER or secretion of the protein rather than proper plasma membrane localization.

  • Functional implications: Mislocalized GAS1 cannot perform its normal cellular functions in cell wall assembly and maintenance.

  • Flanking residue effects: The two amino acids immediately adjacent to the anchor attachment site (on the carboxyl side) are critical for efficient anchoring, with short side chains being preferred and the second position being particularly important .

When designing experiments to study these effects, researchers should consider creating a panel of point mutations at the anchor attachment site and flanking regions, followed by analysis of protein localization, processing kinetics, and functional complementation.

What role does the ER quality control system play in GAS1 processing?

The endoplasmic reticulum (ER) quality control system plays a crucial role in GAS1 processing:

  • Unfolded Protein Response (UPR): High-level expression of recombinant proteins, including GAS1, can trigger the UPR, which influences processing efficiency. When designing GAS1 expression systems, researchers must consider that excessive expression can cause ER stress, potentially affecting experimental outcomes .

  • Chaperone interactions: ER-resident chaperones assist in proper folding of GAS1 before GPI anchor attachment. Key chaperones include:

    • BiP/Kar2p: Binds to hydrophobic regions of nascent proteins

    • PDI: Facilitates disulfide bond formation

    • Calnexin/calreticulin: Interacts with glycoproteins

  • ER-associated degradation (ERAD): Misfolded GAS1 proteins that fail quality control checks are retrotranslocated to the cytosol for proteasomal degradation. This process can significantly affect observed GAS1 yields.

  • Retention mechanisms: The ER contains mechanisms to retain incompletely processed GAS1 until proper folding and GPI anchor attachment occur.

For researchers studying GAS1 processing, modulation of the ER quality control system through overexpression of chaperones or manipulation of UPR components can provide valuable insights into processing bottlenecks.

How can systems biology approaches enhance our understanding of GAS1 and PGA2 interactions?

Systems biology approaches offer powerful frameworks for comprehensively understanding GAS1 and PGA2 interactions:

  • Genomic sequencing analysis: Whole-genome sequencing of wild-type and mutant strains can identify genetic modifications that affect GAS1 processing. This approach is particularly valuable for identifying:

    • Spontaneous mutations that suppress processing defects

    • Evolutionary adaptations in laboratory strains

    • Off-target effects in genetically modified strains

  • Transcriptomic analysis: RNA sequencing or microarray analysis provides insights into gene expression changes in response to PGA2 deletion or GAS1 overexpression. This reveals:

    • Compensatory pathways activated when PGA2 is absent

    • Stress responses triggered by GAS1 processing defects

    • Regulatory networks controlling secretory pathway genes

  • Metabolic flux analysis: This approach measures changes in metabolic pathways when GAS1 processing is perturbed, revealing:

    • Energy requirements for GAS1 processing

    • Metabolic bottlenecks in recombinant protein production

    • Connections between central metabolism and secretory pathway function

  • Integrative analysis using Reporter Feature techniques: This computational approach identifies significant biological features (genes, proteins, metabolites) affected by experimental perturbations. For GAS1 and PGA2 research, this can highlight:

    • Key regulatory nodes in processing networks

    • Previously unrecognized connections between pathways

    • Potential targets for engineering improved processing

Implementation of these approaches requires multidisciplinary collaboration and specialized computational resources, but offers unprecedented insights into the complex systems governing GAS1 processing.

What are the molecular mechanisms underlying PGA2-mediated processing of glycosylated proteins?

The molecular mechanisms of PGA2-mediated processing of glycosylated proteins involve several coordinated processes:

  • Transmembrane domain function: PGA2's transmembrane domains anchor it within the nuclear and ER membranes, positioning it to interact with processing machinery and substrate proteins .

  • Recognition of substrate proteins: PGA2 likely contains specific domains that recognize features of GAS1 and PHO8 (ALP) proteins, distinguishing them from other secretory proteins.

  • Interaction with processing machinery: PGA2 may function as a scaffold that brings together:

    • GPI transamidase complex components

    • Glycosylation enzymes

    • Transport factors for vesicular trafficking

  • Quality control integration: PGA2 potentially coordinates with ER quality control mechanisms to ensure only properly folded proteins proceed through the processing pathway.

  • Trafficking signals: PGA2 may contain or recognize specific signals that direct GAS1 and PHO8 to their appropriate cellular locations after processing.

Research methodologies to elucidate these mechanisms include:

  • Co-immunoprecipitation to identify PGA2 interaction partners

  • Domain mapping through truncation and chimeric protein analysis

  • Cross-linking studies to capture transient processing intermediates

  • Structural biology approaches to determine PGA2 three-dimensional conformation

How do environmental conditions affect GAS1 processing efficiency in recombinant systems?

Environmental conditions significantly impact GAS1 processing efficiency in recombinant systems through multiple mechanisms:

  • Growth rate effects: Research has demonstrated that protein processing efficiency is often inversely correlated with growth rate. Specifically:

    • Lower growth conditions can reduce ER stress for certain recombinant proteins

    • Amylase, for example, achieves higher secretion under lower growth conditions

    • GAS1 processing may similarly benefit from modulated growth rates

  • Oxygen availability: Oxygen levels influence protein folding in the ER:

    • Aerobic conditions support canonical disulfide bond formation

    • Under anaerobic conditions, alternative electron acceptors must be employed for protein folding

    • The electron transferring model for anaerobic conditions suggests specific pathways that may impact GAS1 processing

  • Temperature effects: Temperature modulates:

    • Folding kinetics of nascent proteins

    • Activity of processing enzymes

    • Membrane fluidity affecting trafficking

  • Media composition: Nutrient availability affects:

    • Precursor supply for glycosylation and GPI anchor synthesis

    • Energy availability for secretory pathway functions

    • Induction of stress responses that impact processing

When designing experiments to optimize GAS1 processing, researchers should systematically evaluate these environmental parameters, potentially using a design of experiments (DOE) approach to identify optimal conditions and interactions between variables.

What novel approaches can overcome bottlenecks in recombinant GAS1 expression?

Overcoming bottlenecks in recombinant GAS1 expression requires innovative approaches targeting multiple aspects of the expression system:

  • Engineering the unfolded protein response (UPR): The UPR is a critical determinant of recombinant protein yields. Advanced approaches include:

    • Tuned activation of UPR components to balance protein folding capacity with ER stress

    • Integration of UPR sensors with expression systems to create feedback-controlled production

    • Selective upregulation of beneficial UPR targets while minimizing detrimental stress responses

  • Oxidative stress management: Recombinant protein production generates reactive oxygen species through a futile cycle of protein folding:

    • Implementing thermodynamic models of non-stoichiometric production of reactive oxygen species

    • Engineering electron consumption pathways for protein folding, particularly under anaerobic conditions

    • Enhancing cellular antioxidant capacity to mitigate oxidative damage

  • Vector and expression system design: Advanced design principles include:

    • Modular vector systems with optimal combinations of promoters, terminators, and processing signals

    • Leader sequence optimization for efficient entry into the secretory pathway

    • Strategic codon optimization focusing on rate-limiting steps in translation

  • Host strain engineering: Systematic modification of S. cerevisiae strains can create optimized chassis for GAS1 expression:

    • Random mutagenesis approaches (e.g., UV mutation) combined with high-throughput screening

    • Rational deletion or overexpression of genes identified through systems biology analyses

    • Genome-scale engineering to remove unnecessary pathways that compete for cellular resources

  • Process optimization: Advanced bioprocess strategies include:

    • Developing fed-batch cultivation protocols that maintain optimal growth rates for GAS1 processing

    • Implementing real-time monitoring and control of critical process parameters

    • Designing two-phase cultivation strategies that separate growth and production phases

Implementation of these approaches requires integration of molecular biology, systems biology, and bioprocess engineering expertise, but offers the potential for substantial improvements in recombinant GAS1 expression and processing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.