Recombinant Saccharomyces cerevisiae Prohibitin-2 (PHB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PHB2; YGR231C; G8561; Prohibitin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PHB2
Target Protein Sequence
MNRSPGEFQRYAKAFQKQLSKVQQTGGRGQVPSPRGAFAGLGGLLLLGGGALFINNALFN VDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDLQMVN ITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKVSRL IRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQEKQG MVVRAQGEAKSAELIGEAIKKSRDYVELKRLDTARDIAKILASSPNRVILDNEALLLNTV VDARIDGRGK
Uniprot No.

Target Background

Function

Prohibitin likely functions as a holdase/unfoldase, stabilizing newly synthesized mitochondrial proteins.

Database Links

KEGG: sce:YGR231C

STRING: 4932.YGR231C

Protein Families
Prohibitin family
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is Prohibitin-2 and what are its primary functions in yeast cells?

Prohibitin-2 (Phb2) is a highly conserved mitochondrial protein that forms a high-molecular-weight complex with Prohibitin-1 (Phb1) in the inner mitochondrial membrane. It plays crucial roles in diverse cellular processes including mitochondrial biogenesis, cell proliferation, and maintaining mitochondrial integrity. In yeast, Phb2 contains a transmembrane helix at its N-terminus (approximately amino acids 37 to 59 in S. cerevisiae), which anchors it to the mitochondrial inner membrane, with most of the protein facing the intermembrane space .

The protein is implicated in multiple cellular functions:

  • Maintenance of mitochondrial membrane organization

  • Regulation of mitochondrial protein stability

  • Modulation of cellular stress responses

  • Influence on cell signaling pathways

  • Potential involvement in drug resistance mechanisms

Unlike Phb1, the N-terminal helical region of Phb2 is longer and fulfills the requirements for a membrane-spanning domain, which may explain some of its distinct functions in cellular processes including drug resistance .

How conserved is Prohibitin-2 across fungal species and how does this impact its study?

Prohibitin-2 is remarkably conserved from yeasts to humans, making it an excellent model protein for comparative studies. Specifically, S. pombe Phb2 has homologs in diverse genera of human-pathogenic fungi, including Cryptococcus, Aspergillus, and Candida . This high degree of conservation suggests that findings regarding Phb2 function in S. cerevisiae or S. pombe may have direct relevance to understanding pathogenic fungal biology.

The conservation impacts study design in several ways:

  • Allows for cross-species functional comparisons

  • Enables identification of conserved regulatory mechanisms

  • Provides justification for using S. cerevisiae as a model for pathogenic fungi

  • Suggests potential universal therapeutic targets against fungal infections

What distinguishes Prohibitin-2 functionally from Prohibitin-1 in yeast?

Despite often working together as a complex, Phb2 and Phb1 exhibit distinct functional characteristics:

FeatureProhibitin-2 (Phb2)Prohibitin-1 (Phb1)
Membrane associationStrong transmembrane domainShorter helical region, weaker membrane association
Drug resistance effect (overexpression)Confers resistance to multiple antifungal drugsDoes not confer significant drug resistance when overexpressed
Drug resistance effect (deletion)Confers resistance to multiple antifungal drugsConfers resistance to multiple drugs similar to Phb2 deletion
N-terminal truncation effectsN-terminally truncated version (bp 1-393) sufficient for drug resistanceNot reported

The functional differences likely arise from their structural distinctions, particularly in their N-terminal regions. The transmembrane domain prediction algorithm TMHMM predicts a clear transmembrane helix in Phb2, while Phb1's homologous helical region is shorter and may not fulfill membrane-spanning requirements . This structural difference likely explains why Phb2 shows distinct functions in drug resistance compared to Phb1.

What are the optimal conditions for expressing recombinant Prohibitin-2 in S. cerevisiae?

For effective expression of recombinant Phb2 in S. cerevisiae, researchers should consider the following optimized protocol:

Expression System Setup:

  • Use a strong inducible promoter system (GAL1 promoter for galactose induction or ADH1 for constitutive expression)

  • Incorporate a C-terminal tag (such as His6, FLAG, or RFP) that doesn't interfere with the N-terminal mitochondrial targeting sequence

  • Consider using a low-copy centromeric plasmid (CEN/ARS) for moderate expression or 2μ plasmid for higher expression levels

Growth Conditions:

  • Cultivate cells in selective minimal medium to maintain the expression plasmid

  • For inducible systems, grow cells to mid-log phase (OD600 = 0.5-0.7) in medium containing 2% glucose

  • Induce expression by transferring to medium containing 2% galactose

  • Maintain temperature at 30°C for optimal growth and protein expression

  • Allow 4-6 hours for protein induction (longer periods may lead to protein aggregation)

Verification Methods:

  • Confirm mitochondrial localization using fluorescence microscopy if using fluorescent protein tags

  • Verify expression levels by Western blotting using antibodies against the tag or Phb2 itself

  • Assess protein functionality through complementation assays in phb2Δ strains

Note that overexpression of Phb2 can lead to mitochondrial fragmentation and protein aggregation as observed in fluorescence studies , so expression levels should be carefully controlled depending on the experimental objective.

What methods are most effective for assessing Prohibitin-2's role in antifungal drug resistance?

Based on published research, the following methodological approaches provide robust assessment of Phb2's role in antifungal drug resistance:

Spot/Streak Assays for Drug Sensitivity:

  • Prepare serial dilutions of yeast cultures (starting from OD600 = 1.0, with 10-fold dilutions)

  • Spot 5 μl of each dilution onto YPD plates containing various concentrations of antifungal agents

  • Include a range of drug classes: azoles (clotrimazole, fluconazole), allylamines (terbinafine), polyenes (amphotericin B), and echinocandins (caspofungin)

  • Incubate plates at 30°C for 3-5 days

  • Compare growth patterns between wild-type, Phb2-overexpressing, and phb2Δ strains

Molecular Analysis Techniques:

  • qRT-PCR to quantify changes in mRNA levels of Phb2 and related stress response genes (e.g., pap1+)

  • Western blotting to assess protein expression levels and potential post-translational modifications

  • Fluorescence microscopy with tagged proteins to assess subcellular localization and mitochondrial morphology

  • Measurement of ROS/NO production using fluorescent probes (DCFH-DA for ROS, DAF-FM DA for NO)

Genetic Interaction Studies:

  • Create double knockout strains (e.g., phb2Δ pap1Δ) to assess epistatic relationships

  • Perform rescue experiments by expressing Phb2 in phb2Δ strains

  • Test domain functionality by expressing truncated versions of Phb2

These combined approaches provide comprehensive assessment of Phb2's role in drug resistance, from phenotypic characterization to molecular mechanism elucidation.

How can researchers accurately quantify Prohibitin-2-induced changes in reactive oxygen species and nitric oxide levels?

Accurate quantification of ROS and NO levels is crucial for understanding Phb2's role in cellular stress responses. The following methodological approaches provide reliable measurements:

For ROS Quantification:

  • Use the cell-permeant probe DCFH-DA (2′,7′-dichlorodihydrofluorescein diacetate) at 10-20 μM final concentration

  • Incubate cells with the probe for 30 minutes at 30°C in the dark

  • Wash cells with PBS to remove excess probe

  • Analyze using:

    • Flow cytometry (excitation ~488 nm, emission ~530 nm)

    • Fluorescence microscopy with appropriate filters

    • Plate reader-based assays (96-well format) with kinetic measurements

For NO Quantification:

  • Use the fluorescent NO probe DAF-FM DA (4-amino-5-methylamino-2′,7′-difluorofluorescein diacetate) at 5-10 μM final concentration

  • Incubate cells with the probe for 30 minutes at 30°C in the dark

  • Wash cells with PBS to remove excess probe

  • Analyze using similar detection methods as for ROS

Important Experimental Controls:

  • Include positive controls (H₂O₂ treatment for ROS, NO donor compounds for NO)

  • Use antioxidant treatments as negative controls (e.g., N-acetylcysteine)

  • Measure baseline fluorescence in unstained cells to account for autofluorescence

  • Normalize measurements to cell density or protein content

  • Perform time-course experiments to capture dynamic changes in ROS/NO levels

Research has demonstrated that both overexpression and deletion of the Phb2 gene significantly increased NO and ROS levels in yeast cells, highlighting the complex relationship between Phb2 function and cellular redox state .

How does Prohibitin-2 dysfunction activate the Pap1 transcription factor pathway?

The mechanism by which Phb2 dysfunction activates the Pap1 pathway represents a critical link between mitochondrial function and antifungal drug resistance. Based on experimental evidence, the following sequential events explain this process:

  • Mitochondrial Dysfunction: Either overexpression or deletion of Phb2 disrupts normal mitochondrial architecture and function. With Phb2 overexpression, mitochondria become fragmented, and Phb2 protein aggregates abnormally .

  • Increased ROS/NO Production: Dysfunctional mitochondria generate elevated levels of reactive oxygen species and nitric oxide, as measured by DCFH-DA and DAF-FM DA fluorescent probes respectively .

  • Oxidative Stress Response: The increased ROS/NO acts as a signaling mechanism that activates cellular stress response pathways.

  • Pap1 Activation: The oxidative stress causes Pap1 (a transcription factor homologous to mammalian AP-1) to accumulate in the nucleus, where it can regulate gene expression .

  • Transcriptional Changes: Activated Pap1 upregulates genes involved in detoxification, stress response, and potentially drug efflux mechanisms.

This pathway is evidenced by several experimental observations:

  • Both Phb2 overexpression and deletion significantly increased Pap1 mRNA levels

  • Deletion of the pap1+ gene abolished the drug resistance phenotype caused by Phb2 dysfunction

  • Overexpression of Pap1 alone caused drug resistance similar to that observed with Phb2 dysfunction

This mechanism explains how seemingly opposite interventions (overexpression or deletion) can lead to the same phenotypic outcome of drug resistance through the common pathway of mitochondrial stress and Pap1 activation.

What is the relationship between Prohibitin-2 function and mitochondrial membrane integrity?

Prohibitin-2 plays a critical role in maintaining mitochondrial membrane integrity through several interconnected mechanisms:

Structural Role in Membrane Organization:

  • Phb2 forms a high-molecular-weight complex with Phb1 in the inner mitochondrial membrane

  • This complex creates specialized membrane microdomains that organize the lipid and protein composition

  • The transmembrane domain of Phb2 (amino acids 37-59) anchors the complex to the membrane

Effects of Phb2 Dysfunction on Mitochondrial Membranes:

  • Overexpression of Phb2 leads to mitochondrial fragmentation and abnormal aggregation of Phb2 protein

  • Deletion of Phb2 causes disorganized and fragmented mitochondria

  • Both conditions disrupt the normal architecture of mitochondrial membranes

Functional Consequences:

  • Disrupted membrane integrity alters respiratory chain complex assembly and function

  • Increased electron leakage from the respiratory chain generates elevated ROS levels

  • Membrane disorganization may affect cardiolipin distribution, a phospholipid crucial for mitochondrial function

  • Compromised membranes can lead to increased permeability and potential cytochrome c release

These alterations in mitochondrial membrane integrity directly connect to the phenotypes observed with Phb2 dysfunction, including increased ROS/NO production, activation of stress response pathways (like Pap1), and ultimately, the development of antifungal drug resistance .

Why do both overexpression and deletion of the Prohibitin-2 gene result in similar drug resistance phenotypes?

The paradoxical observation that both overexpression and deletion of Phb2 lead to similar drug resistance phenotypes can be explained through a mechanistic model based on mitochondrial homeostasis disruption:

Common Pathway Model:

  • Disruption of Stoichiometric Balance: The prohibitin complex requires precise stoichiometric ratios of Phb1 and Phb2. Both overexpression and deletion disrupt this balance .

  • Mitochondrial Dysfunction: Both conditions lead to abnormal mitochondrial morphology and function. Overexpression causes protein aggregation and mitochondrial fragmentation, while deletion completely eliminates the structural support provided by Phb2 .

  • ROS/NO Generation as a Common Outcome: Despite different initial perturbations, both conditions increase production of reactive oxygen species and nitric oxide as demonstrated by fluorescent probe experiments .

  • Convergence at Pap1 Activation: The elevated ROS/NO levels activate the transcription factor Pap1 regardless of whether they result from Phb2 overexpression or deletion, as evidenced by increased Pap1 mRNA levels in both conditions .

  • Pap1-Dependent Drug Resistance: The activated Pap1 then orchestrates transcriptional changes that result in reduced susceptibility to multiple antifungal drugs .

This model is supported by the observation that deletion of the Pap1 transcription factor abolished the drug resistance phenotype in both Phb2 overexpression and deletion scenarios, confirming that both interventions converge on the same downstream pathway .

The phenomenon represents a "Goldilocks principle" in mitochondrial homeostasis, where both too much and too little Phb2 disrupt normal function, leading to stress responses that paradoxically enhance cellular resilience to antifungal agents.

How do the functions and phenotypes of Prohibitin-2 differ between S. cerevisiae and S. pombe?

Despite the high conservation of Prohibitin-2 across fungal species, significant functional differences exist between S. cerevisiae and S. pombe Phb2, particularly in relation to drug sensitivity profiles:

CharacteristicS. cerevisiae Phb2S. pombe Phb2
Drug resistance pattern (Phb2 deletion)Sensitive to clotrimazole, fluconazole, amphotericin B, caspofungin, phenylglyoxalResistant to clotrimazole, fluconazole, terbinafine, amphotericin B, phenylglyoxal
Exceptions to patternResistant to terbinafine and 5-FUNot resistant to caspofungin and 5-FU
Effect of Phb2 overexpressionNot fully characterizedConfers resistance to multiple antifungal drugs
Mitochondrial morphology effectsSimilar fragmentation upon Phb2 depletionFragmentation observed with both overexpression and deletion

These species-specific differences highlight important evolutionary divergences in mitochondrial function and stress response mechanisms. The contrasting drug sensitivity profiles between the two yeast species suggest that while Phb2's core functions may be conserved, its integration into cellular response networks has diverged significantly .

The mechanisms underlying these differences remain poorly understood but may involve:

  • Species-specific differences in mitochondrial architecture and function

  • Variations in stress response pathway organization

  • Differences in drug uptake, metabolism, or efflux systems

  • Disparities in cell wall and membrane composition affecting drug permeability

These comparative differences emphasize the importance of species-specific validation when extending findings about Phb2 function across fungal species .

What cellular pathways interact with Prohibitin-2 function to modulate drug resistance?

Prohibitin-2 interacts with multiple cellular pathways to influence drug resistance, creating a complex network of interactions:

1. Oxidative Stress Response Pathway:

  • Phb2 dysfunction activates the Pap1 transcription factor

  • Pap1 regulates genes involved in oxidative stress defense

  • This pathway is essential for Phb2-mediated drug resistance, as pap1+ deletion abolishes the resistance phenotype

2. Mitochondrial Quality Control Mechanisms:

  • Phb2 serves as a receptor for mitophagic machinery

  • Disruption affects mitochondrial turnover and homeostasis

  • Altered mitochondrial quality control influences cellular stress resistance

3. Redox Homeostasis Systems:

  • Both ROS and NO production are increased with Phb2 dysfunction

  • Glutathione-dependent systems (like GRX2) may compensate for redox imbalance

  • Thioredoxin pathways likely play complementary roles in managing oxidative stress

4. Membrane Lipid Organization:

  • Phb2 influences mitochondrial membrane composition and organization

  • Changes in membrane properties may affect drug permeability

  • Cardiolipin distribution and stability could be particularly important

5. Cell Wall Integrity Pathway:

  • Differential sensitivity to caspofungin (a cell wall-targeting drug) suggests intersection with cell wall integrity signaling

  • Cross-talk between mitochondrial dysfunction and cell wall composition may occur

These interconnected pathways create a complex regulatory network through which Phb2 can influence cellular responses to antifungal drugs. The central position of Pap1 activation in this network is highlighted by experimental evidence showing that Pap1 deletion abolishes drug resistance phenotypes associated with Phb2 dysfunction .

How does Prohibitin-2 function compare to other mitochondrial proteins involved in stress responses?

Prohibitin-2 functions distinctively compared to other mitochondrial proteins involved in stress responses, as shown in this comparative analysis:

ProteinSubcellular LocalizationPrimary FunctionRole in Drug ResistanceMechanism of Action
Prohibitin-2 (Phb2)Inner mitochondrial membraneMembrane organization, protein stabilityDysfunction causes resistance to multiple antifungal drugsActivates Pap1 via increased ROS/NO production
Glutaredoxin-2 (GRX2)MitochondriaGlutathione-dependent oxidoreductaseOverexpression decreases susceptibility to apoptosisMaintains redox homeostasis, prevents cytochrome c release
SOD2 (MnSOD)Mitochondrial matrixSuperoxide dismutaseProtection against oxidative stressDirectly detoxifies superoxide radicals
Cytochrome cIntermembrane spaceElectron transportRelease triggers apoptosisPro-apoptotic when released to cytosol
mtHsp70Mitochondrial matrixProtein folding, importStress protectionPrevents protein aggregation during stress

Key distinguishing features of Phb2:

  • Dual-effect phenomenon: Unlike most mitochondrial proteins, both overexpression and deletion of Phb2 produce similar phenotypes .

  • Structural role: Phb2 primarily serves a structural/organizational function rather than a direct enzymatic role in detoxification.

  • Signaling function: Phb2 dysfunction triggers signaling cascades (Pap1 activation) that extend beyond the mitochondria to influence nuclear gene expression .

  • Drug specificity pattern: Phb2 dysfunction affects sensitivity to multiple drug classes but has distinct patterns (e.g., not affecting caspofungin and 5-FU resistance) .

This comparison highlights Phb2's unique position as a mitochondrial protein that influences cellular drug resistance through indirect mechanisms involving altered mitochondrial function and subsequent activation of stress response pathways, rather than through direct detoxification activities.

What are common pitfalls when studying Prohibitin-2 function in yeast systems?

Researchers studying Phb2 in yeast systems should be aware of several methodological challenges and potential pitfalls:

Expression Level Complications:

  • Overexpression can cause artificial aggregation and mitochondrial fragmentation

  • Expression levels from different promoters can vary significantly

  • Constitutive vs. inducible expression systems may yield different phenotypes

  • C-terminal tags may interfere less with function than N-terminal tags (which could disrupt mitochondrial targeting)

Strain Background Effects:

  • Different laboratory strains may show variable phenotypes

  • Auxotrophic markers can influence stress responses independently of Phb2

  • Pre-existing mutations in stress response pathways can confound results

  • Drug sensitivity assays are particularly susceptible to strain background effects

Technical Challenges:

  • Mitochondrial isolation procedures may disrupt Phb2 complexes

  • ROS/NO measurements require careful controls to prevent artifacts

  • Drug concentration ranges must be carefully optimized (e.g., lower concentrations needed for non-plasmid-bearing strains)

  • Microscopy of mitochondrial morphology requires optimized fixation protocols

Data Interpretation Issues:

  • Similar phenotypes from opposite interventions (overexpression vs. deletion) can be confusing

  • Species differences between S. cerevisiae and S. pombe may lead to contradictory results

  • Pleiotropic effects of Phb2 manipulation can complicate pathway analysis

  • Drug resistance phenotypes may vary with growth conditions and media composition

Awareness of these pitfalls allows researchers to design more robust experiments with appropriate controls and validation strategies.

How can researchers resolve contradictory findings when studying Prohibitin-2's role in drug resistance?

When faced with contradictory findings regarding Phb2's role in drug resistance, researchers should implement a systematic troubleshooting approach:

1. Validate Experimental Systems:

  • Confirm Phb2 expression/deletion using multiple methods (qPCR, Western blot)

  • Verify subcellular localization using fluorescence microscopy

  • Sequence confirm all genetic constructs

  • Test multiple independent clones to rule out secondary mutations

2. Reconcile Species-Specific Differences:

  • Consider fundamental differences between yeast species (S. cerevisiae vs. S. pombe)

  • The same genetic manipulation shows opposite drug sensitivity patterns in different species

  • For example, phb2 deletion causes sensitivity to clotrimazole in S. cerevisiae but resistance in S. pombe

3. Address Dosage and Threshold Effects:

  • Test a range of expression levels using different promoters

  • Consider thresholds at which phenotypes manifest

  • Examine time-dependent changes in phenotypes

  • Create dose-response curves for drug treatments

4. Investigate Genetic Background Interactions:

  • Test effects in multiple strain backgrounds

  • Create epistasis maps with related pathway components

  • Particularly examine interactions with stress response factors like Pap1

  • Consider testing double knockout strains (e.g., phb2Δ pap1Δ)

5. Methodological Harmonization:

  • Standardize drug concentrations across experiments

  • Use consistent growth conditions and media formulations

  • Apply the same analytic methods for phenotype quantification

  • Consider that cells harboring plasmids may require different drug concentrations than genomically modified cells

By systematically addressing these factors, researchers can often reconcile seemingly contradictory findings and develop a more nuanced understanding of Phb2's complex role in drug resistance mechanisms.

What alternative approaches can be used when standard Prohibitin-2 expression systems fail?

When standard approaches for Phb2 expression encounter difficulties, researchers can employ several alternative strategies:

1. Inducible Expression Systems:

  • Use tetracycline-regulatable promoters for fine-tuned expression control

  • Implement estradiol-inducible systems that allow gradual induction

  • Consider copper-inducible promoters (CUP1) for moderate expression levels

  • Beta-estradiol inducible systems can provide tight regulation with minimal leakiness

2. Genomic Integration Strategies:

  • Use CRISPR-Cas9 to introduce tagged versions at the native locus

  • Implement auxin-inducible degron tags for controlled protein depletion

  • Create heterozygous diploid strains to maintain one wild-type copy

  • Use recombination-based knock-in approaches for physiological expression levels

3. Domain-Focused Approaches:

  • Express specific functional domains of Phb2 rather than the full protein

  • The N-terminal region (bp 1-393) has been shown to be sufficient for some functions

  • Create chimeric proteins with domains from related prohibitins

  • Use mini-Phb2 constructs focusing on critical functional regions

4. Alternative Host Systems:

  • If S. cerevisiae expression is problematic, try S. pombe as an alternative system

  • Consider Pichia pastoris for higher protein yields

  • Use reconstituted liposome systems for studying membrane interactions

  • Employ cell-free expression systems for difficult-to-express constructs

5. Specialized Purification Strategies:

  • Use mild detergents (digitonin, DDM) for membrane protein extraction

  • Implement on-column refolding protocols

  • Consider nanodiscs for membrane protein stabilization

  • Use split-tag approaches to isolate intact prohibitin complexes

These alternative approaches provide researchers with multiple options when standard expression systems fail to yield functional Phb2 protein, enabling continued investigation of this important mitochondrial regulator.

What are the most promising therapeutic applications of understanding Prohibitin-2 function in antifungal resistance?

Understanding Phb2's role in antifungal resistance opens several promising therapeutic avenues:

1. Novel Antifungal Adjuvant Development:

  • Compounds targeting Phb2 or its regulatory pathways could sensitize resistant fungi to existing antifungals

  • Inhibitors of Pap1 activation might reverse Phb2-mediated drug resistance

  • Mitochondrial-targeted antioxidants could potentially disrupt the ROS-dependent resistance mechanism

  • Combination therapies targeting both conventional drug targets and Phb2 pathways could improve efficacy

2. Resistance Mechanism Prediction Tools:

  • Diagnostic platforms to identify Phb2 dysfunction in clinical isolates

  • Biomarkers based on Phb2 expression levels or mitochondrial morphology

  • Pre-treatment screening to guide optimal antifungal selection

  • Monitoring tools to detect emerging resistance through Phb2 pathway activation

3. Cross-Species Applications:

  • Given Phb2's conservation across pathogenic fungi (Cryptococcus, Aspergillus, Candida), therapies could have broad-spectrum applications

  • Species-specific variations in resistance mechanisms can be exploited for targeted interventions

  • Interventions validated in model yeasts could inform treatments for pathogenic fungi

4. Mitochondrial-Targeted Antifungals:

  • New drug classes targeting mitochondrial functions disturbed by Phb2 dysfunction

  • Compounds that selectively disrupt fungal mitochondrial membranes

  • Agents that interfere with the prohibitin complex assembly

  • Drugs exploiting the mitochondrial fragmentation phenotype observed with Phb2 dysfunction

Understanding the Phb2-Pap1-ROS axis offers a promising new direction for combating antifungal resistance, potentially addressing a critical need in treating invasive fungal infections that are increasingly resistant to conventional therapies .

What genomic and proteomic approaches would advance our understanding of Prohibitin-2 interaction networks?

Advanced genomic and proteomic approaches would significantly deepen our understanding of Phb2 interaction networks:

1. Comprehensive Interactome Analysis:

  • Proximity-dependent biotin identification (BioID) to identify proteins in close proximity to Phb2

  • Split-BioID approaches for mapping dynamic interactions

  • Quantitative SILAC-based co-immunoprecipitation to identify condition-dependent interactions

  • Cross-linking mass spectrometry (XL-MS) to map protein-protein interaction interfaces

  • Thermal proximity co-aggregation (TPCA) to detect functional interactions in native conditions

2. Transcriptomic Profiling Approaches:

  • RNA-Seq comparing wild-type, Phb2-overexpressing, and phb2Δ strains

  • Temporal transcriptome analysis during drug exposure

  • Single-cell RNA-Seq to capture heterogeneity in cellular responses

  • Ribosome profiling to assess translational changes

  • Comparative transcriptomics between S. cerevisiae and S. pombe to identify conserved response elements

3. Functional Genomic Screens:

  • Genome-wide CRISPR screens for genes synthetically lethal with phb2Δ

  • Synthetic genetic array (SGA) analysis to map genetic interaction networks

  • Chemical-genetic profiling to identify drug-specific interaction patterns

  • Multicopy suppressor screens to identify genes that rescue Phb2 dysfunction phenotypes

4. Structural and Membrane Proteomics:

  • Cryo-EM analysis of the prohibitin complex architecture

  • Lipid-protein interaction mapping using photoactivatable lipid probes

  • Protein topology analysis using limited proteolysis

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic structural changes

5. Systems Biology Integration:

  • Multi-omics data integration to construct comprehensive Phb2 regulatory networks

  • Network analysis to identify key regulatory hubs connected to Phb2 function

  • Metabolomic profiling to capture changes in mitochondrial metabolism

  • Flux analysis to trace metabolic rewiring in response to Phb2 dysfunction

These approaches would collectively provide a multidimensional view of Phb2's role in cellular functions and antifungal resistance mechanisms, potentially revealing new intervention points for therapeutic development.

How might CRISPR-based methods advance functional studies of Prohibitin-2 in drug resistance mechanisms?

CRISPR-based technologies offer powerful new approaches for studying Phb2 function in drug resistance:

1. Precise Genomic Manipulation:

  • Generation of clean knockouts without selection markers that might affect phenotypes

  • Introduction of point mutations to study specific functional domains

  • Creation of truncation variants to dissect domain functions

  • Introduction of fluorescent tags at endogenous loci for live-cell imaging

  • Engineering of conditional alleles for temporal control of Phb2 expression

2. High-Throughput Functional Screens:

  • Genome-wide CRISPR screens to identify synthetic lethal or synthetic rescue interactions with phb2Δ

  • CRISPR activation (CRISPRa) screens to identify genes whose upregulation modifies Phb2-dependent phenotypes

  • CRISPR interference (CRISPRi) to create hypomorphic alleles for dosage-sensitive studies

  • Pooled CRISPR screens in the presence of antifungal drugs to map resistance mechanisms

3. Temporal and Spatial Control Systems:

  • Optogenetic CRISPR systems for light-controlled Phb2 expression

  • Chemical-inducible degradation of Phb2 for rapid protein depletion

  • Tissue-specific CRISPR systems for studying Phb2 in multicellular fungal structures

  • CRISPR-based biosensors to monitor mitochondrial stress responses in real-time

4. Evolutionary and Comparative Studies:

  • Simultaneous editing of Phb2 orthologs across multiple fungal species

  • Creation of chimeric Phb2 proteins with domains from different species

  • Introduction of clinically-observed Phb2 variants into model systems

  • Engineering humanized yeast strains expressing human PHB2 to study conservation of function

5. Base and Prime Editing Applications:

  • Introduction of specific mutations without double-strand breaks

  • Precise modification of regulatory regions controlling Phb2 expression

  • Targeted epigenetic modifications to alter Phb2 expression patterns

  • Scarless introduction of reporter sequences for monitoring Phb2 activity

These CRISPR-based approaches would provide unprecedented precision in manipulating Phb2 and related pathways, enabling more sophisticated analysis of its role in antifungal drug resistance mechanisms and potentially revealing new strategies for therapeutic intervention.

How should researchers design experiments to investigate the relationship between Prohibitin-2 and specific antifungal drug classes?

A comprehensive experimental design to investigate Phb2's relationship with different antifungal drug classes should include:

1. Systematic Drug Sensitivity Profiling:

  • Test a panel of drugs representing major antifungal classes:

    • Azoles (fluconazole, clotrimazole, itraconazole)

    • Polyenes (amphotericin B, nystatin)

    • Echinocandins (caspofungin, micafungin)

    • Allylamines (terbinafine)

    • Nucleoside analogs (5-fluorocytosine)

  • Determine minimum inhibitory concentrations (MICs) using broth microdilution

  • Perform time-kill assays to assess fungicidal versus fungistatic effects

  • Create full dose-response curves rather than testing single concentrations

2. Genetic Manipulation Strategy:

  • Compare multiple genetic backgrounds:

    • Wild-type control

    • Phb2 overexpression (both full-length and N-terminal truncation)

    • phb2Δ deletion mutant

    • Conditional depletion strains

    • Double mutants with key pathway components (e.g., phb2Δ pap1Δ)

  • Use both plasmid-based and genomic integration approaches

  • Include appropriate empty vector controls

3. Mechanistic Investigation Approaches:

  • Assess drug uptake using fluorescent derivatives or radiolabeled compounds

  • Measure drug efflux activity through rhodamine 6G accumulation assays

  • Monitor expression of known drug resistance genes

  • Quantify mitochondrial membrane potential using potentiometric dyes

  • Measure ROS/NO production with specific fluorescent probes

  • Assess Pap1 nuclear localization using fluorescent tagging

4. Combination Studies:

  • Test drug synergy using checkerboard assays

  • Combine antifungals with mitochondrial inhibitors

  • Evaluate antioxidant effects on drug sensitivity

  • Test potential adjuvants that target Phb2 pathways

5. Translation to Pathogenic Species:

  • Validate key findings in pathogenic fungi (Candida, Aspergillus)

  • Compare drug-specific effects across species

  • Assess clinical isolates with varying drug resistance profiles

This systematic approach would provide comprehensive insights into how Phb2 function influences susceptibility to different antifungal drug classes and potentially identify novel therapeutic strategies.

What controls are essential when investigating Prohibitin-2's role in mitochondrial redox signaling?

When investigating Phb2's role in mitochondrial redox signaling, the following controls are essential to ensure robust and interpretable results:

1. Genetic Controls:

  • Wild-type parental strain (same genetic background as experimental strains)

  • Empty vector controls for overexpression studies

  • Complemented knockout strain (phb2Δ + Phb2) to confirm phenotype rescue

  • phb1Δ strains to distinguish Phb2-specific effects from general prohibitin complex disruption

  • pap1Δ strains as negative controls for Pap1-dependent effects

2. ROS/NO Measurement Controls:

  • Unstained cells to establish autofluorescence baseline

  • Positive controls: H₂O₂ treatment (for ROS), nitric oxide donors like SNAP (for NO)

  • Negative controls: Antioxidant pre-treatment (N-acetylcysteine, ascorbate)

  • Mitochondrial uncouplers (CCCP) to assess contribution of mitochondrial dysfunction

  • Time-course measurements to capture dynamic changes

3. Drug Treatment Controls:

  • Solvent-only controls (DMSO, ethanol) at equivalent concentrations

  • Drug concentration titrations to establish dose-response relationships

  • Time-course experiments to distinguish primary from secondary effects

  • Multiple drug classes to differentiate mechanism-specific from general effects

4. Experimental Validation Controls:

  • Multiple independent methods for measuring the same parameter

  • Biological replicates from independent transformations/isolates

  • Technical replicates to assess method variability

  • Positive controls with known redox-active compounds

  • Negative controls with redox-neutral interventions

5. Mitochondrial Function Controls:

  • Assessment of mitochondrial membrane potential (TMRM, JC-1 dyes)

  • Measurement of oxygen consumption rates

  • Evaluation of mitochondrial morphology (mitotracker staining)

  • Tests of mitochondrial protein import efficiency

  • Assessment of mtDNA stability and copy number

Implementing these controls ensures that observed effects are specifically attributable to Phb2's role in mitochondrial redox signaling rather than to experimental artifacts or secondary consequences of mitochondrial dysfunction.

What are the key considerations for translating findings about Prohibitin-2 from model yeasts to pathogenic fungi?

Translating findings about Phb2 from model yeasts to pathogenic fungi requires careful consideration of several factors:

1. Evolutionary Conservation Assessment:

  • Perform comparative sequence analysis of Phb2 across species

  • Generate phylogenetic trees to understand evolutionary relationships

  • Identify conserved domains versus species-specific regions

  • Map known functional residues across species

  • Assess conservation of interacting partners (e.g., Pap1 homologs)

2. Functional Homology Validation:

  • Test if pathogenic fungal Phb2 complements S. cerevisiae or S. pombe phb2Δ

  • Create chimeric proteins with domains from different species

  • Compare subcellular localization patterns across species

  • Assess protein-protein interactions of Phb2 orthologs

  • Evaluate conservation of regulatory mechanisms

3. Species-Specific Differences Consideration:

  • Acknowledge divergent drug sensitivity patterns (e.g., S. cerevisiae vs. S. pombe)

  • Assess differences in mitochondrial biology between species

  • Consider variations in stress response pathways

  • Evaluate differences in cell wall/membrane composition affecting drug access

  • Account for pathogenesis-related adaptations in clinical species

4. Methodological Adaptations:

  • Optimize transformation protocols for each fungal species

  • Adjust drug concentrations based on species-specific sensitivity

  • Develop appropriate reporter systems for each organism

  • Consider growth conditions relevant to infection contexts

  • Adapt genetic manipulation strategies to each species' requirements

5. Clinical Relevance Assessment:

  • Test findings using clinical isolates with varying drug resistance profiles

  • Evaluate Phb2 expression in drug-resistant clinical strains

  • Assess correlation between Phb2 levels and clinical outcomes

  • Consider host-pathogen interactions in infection models

  • Evaluate potential for therapeutic targeting in different fungal pathogens

By carefully addressing these considerations, researchers can more effectively translate mechanistic findings about Phb2 from model yeasts to clinically relevant pathogenic fungi, potentially leading to new therapeutic strategies for combating drug-resistant fungal infections .

What are the most significant unanswered questions regarding Prohibitin-2's role in antifungal drug resistance?

Despite considerable progress in understanding Phb2's involvement in antifungal drug resistance, several significant questions remain unanswered:

1. Mechanistic Paradox Resolution:

  • How can both overexpression and deletion of Phb2 lead to similar drug resistance phenotypes?

  • What is the precise mechanism by which Phb2 dysfunction increases ROS/NO production?

  • Is there a threshold effect or biphasic response curve for Phb2 function?

  • Are there undiscovered regulatory mechanisms that explain this paradoxical behavior?

2. Species-Specific Variations:

  • Why does Phb2 deletion cause opposite drug sensitivity patterns in S. cerevisiae versus S. pombe?

  • How conserved is the Phb2-Pap1-ROS axis across diverse fungal species?

  • Do pathogenic fungi utilize Phb2-related mechanisms for developing clinical resistance?

  • Are there species-specific interacting partners that modify Phb2 function?

3. Structural and Functional Relationships:

  • Which domains of Phb2 are critical for its role in drug resistance?

  • How does the N-terminal region (bp 1-393) mediate resistance phenotypes?

  • What structural changes occur in mitochondrial membranes upon Phb2 dysfunction?

  • How does Phb2 structurally interact with other components of the prohibitin complex?

4. Downstream Effector Mechanisms:

  • Which genes are regulated by Pap1 following Phb2 dysfunction?

  • Are drug efflux pumps upregulated as part of the resistance mechanism?

  • How does altered mitochondrial function impact drug target accessibility?

  • Are there changes in cell wall or membrane composition that affect drug penetration?

5. Therapeutic Potential:

  • Can Phb2-mediated resistance mechanisms be targeted for therapeutic intervention?

  • Would combination therapies targeting both conventional mechanisms and Phb2 pathways be effective?

  • Could biomarkers of Phb2 dysfunction predict antifungal resistance in clinical settings?

  • How might targeting Phb2 affect host cells given its conservation across eukaryotes?

Addressing these questions would significantly advance our understanding of Phb2's role in antifungal drug resistance and potentially lead to novel therapeutic strategies for combating resistant fungal infections.

How does current knowledge of Prohibitin-2 contribute to our broader understanding of mitochondrial roles in drug resistance?

Current knowledge of Phb2 significantly contributes to our understanding of mitochondrial roles in drug resistance through several conceptual advances:

1. Mitochondria as Signaling Hubs:

  • Phb2 research demonstrates that mitochondria are not just passive targets of drug toxicity but active participants in resistance mechanisms

  • Mitochondrial dysfunction triggers adaptive signaling cascades (like Pap1 activation) that can paradoxically enhance cellular survival

  • The finding that both overexpression and deletion of Phb2 activate similar resistance pathways suggests complex homeostatic control mechanisms

2. ROS/NO as Signaling Molecules:

  • Phb2 dysfunction increases ROS/NO production, which acts as signaling molecules rather than just damaging agents

  • These reactive species activate transcription factors (like Pap1) that orchestrate broad cellular adaptations

  • This represents a paradigm shift from viewing ROS solely as detrimental to recognizing their role in adaptive responses

3. Mitochondrial Membrane Organization:

  • Phb2's role highlights the importance of mitochondrial membrane architecture in drug resistance

  • Disruption of membrane organization can alter drug accumulation, distribution, and efficacy

  • The prohibitin complex's function in creating specialized membrane domains may influence drug-target interactions

4. Cross-Compartment Coordination:

  • Phb2 research demonstrates how mitochondrial events trigger nuclear transcriptional responses

  • This mitochondria-to-nucleus signaling (retrograde signaling) coordinates whole-cell adaptations to stress

  • The discovery that Pap1 activation depends on Phb2 dysfunction illustrates this inter-organelle communication

5. Evolutionary Conservation and Divergence:

  • The different drug resistance phenotypes between S. cerevisiae and S. pombe Phb2 mutants highlight how conserved proteins can evolve species-specific functions

  • This suggests caution in extrapolating resistance mechanisms across fungal species

  • It also indicates potential for targeted interventions that exploit species-specific differences

These insights have broader implications for understanding how mitochondrial function influences drug resistance across diverse organisms, potentially informing new therapeutic strategies that target these fundamental cellular processes.

What integrative approaches would best advance our understanding of Prohibitin-2 biology across fungal species?

Advancing Prohibitin-2 biology across fungal species requires integrative approaches that combine multiple disciplines and technologies:

1. Multi-Species Comparative Genomics:

  • Sequence Phb2 and associated pathway components across diverse fungal lineages

  • Identify conserved motifs, species-specific variations, and evolutionary patterns

  • Correlate sequence variations with functional differences

  • Create a comprehensive phylogenetic framework for understanding Phb2 evolution

2. Systems Biology Integration:

  • Develop interactome maps for Phb2 across multiple fungal species

  • Perform comparative transcriptomics under drug stress conditions

  • Integrate proteomics, metabolomics, and lipidomics data into network models

  • Use machine learning to identify conserved versus divergent response patterns

  • Create predictive models of Phb2-mediated drug resistance across species

3. Structural Biology and Molecular Dynamics:

  • Determine high-resolution structures of Phb2 from multiple fungal species

  • Model Phb2-Phb1 complex assembly in mitochondrial membranes

  • Simulate molecular dynamics of Phb2 interactions with membrane components

  • Identify binding sites for potential small molecule modulators

  • Visualize structural changes associated with dysfunction-induced signaling

4. Translational Research Pipeline:

  • Create a panel of model and pathogenic fungi with standardized Phb2 modifications

  • Develop high-throughput screening platforms for Phb2 pathway modulators

  • Test candidate compounds against diverse fungal species

  • Validate findings in clinical isolates with varying drug resistance profiles

  • Design combination therapy approaches targeting conventional and Phb2-related mechanisms

5. Collaborative Research Frameworks:

  • Establish consortia focusing on Phb2 biology across fungal species

  • Create standardized protocols and resources for cross-species comparisons

  • Develop shared databases of Phb2 variants and associated phenotypes

  • Implement common experimental platforms for direct comparisons

  • Coordinate clinical sampling to connect basic research with medical applications

These integrative approaches would create a comprehensive understanding of Phb2 biology across fungal species, potentially leading to novel antifungal strategies targeting conserved vulnerability points while accounting for species-specific variations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.