Recombinant Saccharomyces cerevisiae Protein ASG7 (ASG7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ASG7; YJL170C; J0514; Protein ASG7; A-specific gene 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ASG7
Target Protein Sequence
MTTLASSIEHKTKHLAAPFENDENPWMKKYCCQCKSCKMSVPVQPWLPRFFVFGILCPVF WLVNLLAWWFLQYWQPHELEFHDLQEDEYPGFYEYEAITKRTVIPIKEEVLQEIRVMQNF SDSNSEEYYESKDGMPSSFLNVNTEQVEDENDTLKKYRYAFLKKVAHDVLESHDLLRKTF RDWNLRSLLGLLIDSILIIFVVLLCKKSR
Uniprot No.

Target Background

Function

Required for receptor inhibition of inappropriately expressed α-factor receptor (STE3) in MATa cells. It inhibits signaling by relocalizing the G protein β-γ (STE4-STE18) subunit to intracellular membranes. This may also be a mechanism for down-regulating the mating pheromone response post-zygotic fusion, facilitating the transition of the new diploid cell to vegetative growth.

Database Links

KEGG: sce:YJL170C

STRING: 4932.YJL170C

Subcellular Location
Endomembrane system; Multi-pass membrane protein.

Q&A

What is ASG7 and what are its structural characteristics?

ASG7 is a protein-coding gene in Saccharomyces cerevisiae that encodes a 214-residue protein with two potential transmembrane domains . The ASG7 gene (Entrez Gene ID: 853269) produces a protein that appears to exist as a monomer in its natural state, as determined through size exclusion chromatography studies of similar yeast proteins . While ASG7 itself has not been extensively characterized structurally, studies of other yeast proteins suggest that circular dichroism (CD) spectroscopy would likely reveal characteristic α-helical features, particularly given the presence of transmembrane domains .

For structural characterization, researchers should consider:

  • Recombinant expression with fusion tags (e.g., His-tag) for purification

  • Size exclusion chromatography to confirm monomeric state

  • Far-UV CD spectroscopy to determine secondary structure elements

  • Fluorescence spectroscopy to evaluate tertiary structure

What cellular functions has ASG7 been implicated in?

ASG7 participates in multiple cellular processes in Saccharomyces cerevisiae, with functions specifically in "a" cells of the yeast mating system. Research has identified the following roles:

  • Regulation of pheromone signaling through a Ste3p-dependent mechanism

  • Involvement in bud morphogenesis during cell division

  • Contribution to proper zygote formation and development after mating

  • Regulation of cell cycle progression, particularly in the G1 phase

  • Promotion of proper timing in first mitotic bud emergence after zygote formation

These diverse functions suggest ASG7 may serve as an integrator of mating-specific signaling with cell cycle control mechanisms. The protein's cellular functions are a-cell specific, indicating its specialized role in mating-type specific cellular processes .

How is ASG7 expression regulated in yeast cells?

ASG7 expression is strictly limited to "a" cells in Saccharomyces cerevisiae, making it an a-specific gene . This restriction suggests tight transcriptional control linked to mating type identity. Experimental evidence shows that:

  • Natural expression only occurs in MATa cells, not in MATα cells

  • Constitutive expression using the ADH1 promoter (ADH1-ASG7) is not deleterious to cell growth in either "a" or α cells

  • Expression can be artificially induced in laboratory settings using constitutive promoters like ADH1

For studying ASG7 expression, researchers should consider:

  • Using quantitative PCR to measure expression levels in different cell types

  • Employing promoter-reporter constructs to identify regulatory elements

  • Analyzing expression during different phases of the cell cycle and mating response

What is the mechanism of ASG7's role in Ste3p-dependent suppression of pheromone signaling?

ASG7 functions in a complex regulatory pathway involving the Ste3p pheromone receptor and the Ste4 signaling component. Experimental evidence reveals:

  • ASG7 is required for suppression of GAL1-STE4-induced growth arrest, but only when Ste3p is co-expressed

  • Introduction of ADH1-ASG7 restores growth on galactose medium to MATa GAL1-STE4 GAL1-STE3 asg7Δ cells

  • This suppression fails in MATa GAL1-STE4 asg7Δ cells lacking Ste3p

  • When artificially expressed in α cells, ASG7 can also suppress GAL1-STE4 in a Ste3p-dependent manner

These findings suggest a model where ASG7 and Ste3p cooperatively regulate Ste4-mediated signaling pathways. To investigate this mechanism further, researchers should:

  • Perform co-immunoprecipitation studies to detect physical interactions between ASG7 and Ste3p

  • Create truncation and point mutants to map interaction domains

  • Use phosphorylation-specific antibodies to track signaling events downstream of Ste4

  • Employ fluorescence microscopy to determine if ASG7 affects Ste3p localization or trafficking

How does ASG7 deletion affect zygote development and cell cycle progression?

Deletion of ASG7 (asg7Δ) results in significant developmental abnormalities in newly formed zygotes, particularly affecting morphology and cell cycle timing. Experimental data shows:

Time pointWild-type zygotes with buds (%)asg7Δ zygotes with buds
2.0 hours21%Significantly delayed
2.5 hoursIncreased from 2.0hSignificantly delayed
3.0 hoursFurther increasedSignificantly delayed

The emergence of the first mitotic bud is substantially delayed in asg7Δ zygotes . This delay could result from either:

  • Derangement of the budding site, affecting the physical process of bud formation

  • A cell cycle delay, specifically a slow transition from G1 to S phase

Interestingly, despite these abnormalities, other aspects of zygotic development appear to proceed normally, and mating efficiency remains at wild-type levels . This suggests ASG7 has a specific role in coordinating cell cycle entry with morphological development in newly formed zygotes.

What experimental approaches can best characterize ASG7's protein-protein interactions and signaling networks?

To comprehensively map ASG7's interactions and signaling networks, researchers should employ multiple complementary approaches:

  • Affinity Purification Mass Spectrometry (AP-MS)

    • Express tagged ASG7 (e.g., TAP-tag or His-tag) in yeast cells

    • Purify ASG7 complexes under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions by reciprocal tagging and co-immunoprecipitation

  • Yeast Two-Hybrid Screening

    • Use ASG7 as bait to screen for interacting proteins

    • Create domain-specific constructs to map interaction regions

    • Validate interactions in vivo using co-localization studies

  • Genetic Interaction Analysis

    • Perform synthetic genetic array (SGA) analysis with asg7Δ strains

    • Identify genetic suppressors and enhancers of asg7Δ phenotypes

    • Create double mutants with genes in related pathways (e.g., mating, cell cycle)

  • Phosphoproteomics

    • Compare phosphorylation patterns between wild-type and asg7Δ strains

    • Identify signaling pathways affected by ASG7 deletion

    • Look specifically at changes in mating and cell cycle regulatory proteins

These approaches would help construct a comprehensive map of ASG7's functional interactions and place it within the broader cellular signaling network.

What are the optimal conditions for recombinant expression and purification of ASG7?

Based on successful approaches with similar yeast proteins, researchers should consider the following protocol for recombinant ASG7 expression and purification:

Expression System Selection:

  • Bacterial expression: Use pET21d(+) vector with T7 promoter and lac operator for controlled expression

  • Yeast expression: Consider using native S. cerevisiae with ADH1 promoter for homologous expression

  • Insect cell expression: Baculovirus-infected Sf21 cells for complex eukaryotic proteins

Expression Optimization:

  • Include an affinity tag (6xHis-tag recommended) at N- or C-terminus

  • For membrane proteins like ASG7 with transmembrane domains, optimize detergent conditions

  • Consider temperature reduction (16-20°C) during induction to improve folding

Purification Protocol:

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Size Exclusion Chromatography (SEC) to ensure homogeneity and determine oligomeric state

  • Western blotting with anti-His antibodies to confirm identity and purity

Quality Assessment:

  • Circular Dichroism (CD) spectroscopy for secondary structure analysis, expecting α-helical characteristics (negative minima at 222 and 208 nm)

  • Fluorescence spectroscopy to evaluate tertiary structure and folding

  • Thermal stability assays to determine optimal buffer conditions

This approach has proven successful for similar yeast proteins with transmembrane domains and should provide high-quality recombinant ASG7 for functional and structural studies.

What mutagenesis strategies are most effective for structure-function analysis of ASG7?

To systematically investigate ASG7's structure-function relationships, researchers should implement multiple mutagenesis approaches:

  • Alanine-Scanning Mutagenesis

    • Create series of mutations replacing 3-5 consecutive residues with alanine

    • Target conserved regions and predicted functional domains

    • Assay for complementation of asg7Δ phenotypes

    • Identify critical functional regions in the protein

  • Transmembrane Domain Modifications

    • Alter or delete predicted transmembrane domains

    • Replace with transmembrane domains from unrelated proteins

    • Assess effects on localization and function

    • Determine if membrane association is essential for activity

  • Domain Deletion and Swapping

    • Create truncation mutants to identify minimal functional domains

    • Swap domains with homologs from related yeast species

    • Test chimeric proteins for functional complementation

    • Map species-specific functional regions

  • Site-Directed Mutagenesis of Conserved Residues

    • Target evolutionarily conserved residues

    • Focus on predicted post-translational modification sites

    • Create phosphomimetic mutations (S/T→D/E) if phosphorylation is suspected

    • Assay for altered activity, localization, or interaction profiles

Each mutant should be tested in functional assays measuring:

  • Ability to suppress Ste4-induced growth arrest in the presence of Ste3p

  • Rescue of zygote morphology and first bud emergence timing

  • Protein localization and stability

  • Interaction with known binding partners

How can researchers develop quantitative assays to measure ASG7 function in vivo?

Quantitative measurement of ASG7 function requires development of robust, reproducible assays that capture its diverse cellular roles:

  • Growth Suppression Assay

    • Use GAL1-STE4 GAL1-STE3 strains with and without ASG7

    • Measure growth curves in galactose medium using microplate readers

    • Calculate growth rates and lag phases quantitatively

    • Normalize to glucose growth to account for strain-specific differences

  • Zygote Development Assay

    • Time-lapse microscopy of mating mixtures

    • Automated image analysis to track:

      • Time to first bud emergence

      • Bud size and growth rate

      • Zygote morphology parameters

    • Statistical analysis comparing wild-type and mutant populations

  • Fluorescent Reporter Systems

    • Create ASG7-fluorescent protein fusions to track localization

    • Develop pheromone-responsive transcriptional reporters (e.g., FUS1-GFP)

    • Measure signaling dynamics in single cells via flow cytometry or microscopy

    • Quantify response kinetics and population heterogeneity

  • Cell Cycle Progression Assay

    • Synchronize cells by α-factor arrest or elutriation

    • Track cell cycle phases using flow cytometry

    • Measure expression of phase-specific markers

    • Compare timing of G1-to-S transition in wild-type versus asg7Δ strains

Implementation of these quantitative approaches will provide more precise understanding of ASG7's functions and enable detection of subtle phenotypes that might be missed in qualitative assessments.

How should researchers interpret contradictory data regarding ASG7 function?

Contradictions in experimental data regarding ASG7 function may arise from various factors and require systematic analysis approaches. Drawing from principles of contradiction analysis in scientific data:

  • Define the Contradiction Parameters

    • Identify the number of interdependent items (α)

    • Enumerate contradictory dependencies defined by experts (β)

    • Determine the minimal number of Boolean rules needed (θ)

  • Consider Experimental Context

    • Strain background differences (W303 vs S288C)

    • Growth conditions (temperature, media composition)

    • Cell synchronization methods

    • Protein expression levels in recombinant systems

  • Reconciliation Strategies

    • Test multiple strains under identical conditions

    • Implement Boolean minimization to identify critical variables

    • Develop quantitative models that incorporate context-dependence

    • Consider that ASG7 may have multiple functions with different activation thresholds

For example, if contradictions arise regarding ASG7's effect on cell cycle progression, researchers should systematically test different genetic backgrounds, synchronization methods, and environmental conditions, then apply Boolean logic to identify the minimal set of variables that explain the observed patterns .

What bioinformatic approaches are most valuable for predicting ASG7 functional domains?

Computational analysis of ASG7 can provide valuable insights into its functional domains and guide experimental design:

  • Sequence Analysis Tools

    • Multiple sequence alignment of ASG7 homologs to identify conserved regions

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Secondary structure prediction (PSIPRED, JPred)

    • Disorder prediction (PONDR, IUPred)

  • Structural Modeling

    • Ab initio modeling for regions lacking homology to known structures

    • Template-based modeling if structural homologs exist

    • Membrane protein specific modeling tools for transmembrane regions

    • Molecular dynamics simulations to assess conformational dynamics

  • Functional Annotation

    • Gene Ontology enrichment of predicted interacting partners

    • Pathway analysis using KEGG and Reactome databases

    • Analysis of post-translational modification sites

    • Identification of protein sorting and localization signals

  • Protein Fingerprinting

    • PIPSA (Protein Interaction Property Similarity Analysis) to identify species-specific characteristics

    • Electrostatic potential mapping

    • Hydrophobicity analysis

    • Binding site prediction

These bioinformatic approaches should be integrated to develop a comprehensive prediction of ASG7's functional architecture, guiding the design of targeted experiments to validate computational hypotheses.

How can systems biology approaches integrate ASG7 into broader cellular networks?

Understanding ASG7's role in the broader cellular context requires integration of multiple data types and network-level analysis:

  • Transcriptomic Profiling

    • Compare gene expression between wild-type and asg7Δ strains

    • Analyze expression changes during mating and zygote formation

    • Identify co-regulated gene clusters

    • Map transcription factor binding sites in differentially expressed genes

  • Protein Interaction Network Analysis

    • Place ASG7 and its interacting partners in the global yeast interactome

    • Identify network modules containing ASG7

    • Calculate network centrality measures to assess ASG7's importance

    • Perform network perturbation simulations

  • Pathway Integration

    • Map ASG7 functions to established signaling pathways

    • Identify points of crosstalk between mating and cell cycle pathways

    • Construct visual pathway maps incorporating ASG7

    • Develop mathematical models of pathway dynamics

  • Multi-omics Data Integration

    • Combine transcriptomic, proteomic, and metabolomic data

    • Apply machine learning for pattern recognition

    • Construct predictive models of system behavior

    • Visualize data using dimensionality reduction techniques

By applying these systems approaches, researchers can position ASG7 within its functional context and better understand how its diverse roles contribute to cellular physiology and mating-specific regulation.

What are the most promising future directions for ASG7 research?

Based on current knowledge gaps and technological capabilities, the most promising research directions for ASG7 include:

  • Structural Biology

    • Determination of the 3D structure through X-ray crystallography or cryo-EM

    • Mapping of protein-protein interaction interfaces

    • Analysis of conformational changes during signaling

  • Systems-Level Function

    • Integration of ASG7 into comprehensive models of yeast mating responses

    • Exploration of cell-to-cell variability in ASG7 function using single-cell approaches

    • Investigation of potential roles in stress responses and adaptation

  • Translational Applications

    • Exploration of ASG7 homologs in pathogenic fungi

    • Development of screening systems using ASG7 pathways

    • Utilization of ASG7 regulatory mechanisms for synthetic biology applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.