Recombinant Saccharomyces cerevisiae Protein CBP3, mitochondrial (CBP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CBP3; YPL215W; P1775; Protein CBP3, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-335
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
CBP3
Target Protein Sequence
ETAQDSPELLAKSSHLNSKPLDVSNKAPVKTAQNKIPLAHSKYESSKYELPKWKEALGEL VIRAFHLDMDRVRAGPVAGSYYYKICKEQGLQYEDEPLSETAKYFYEDLKLPRTFSQWFQ ITVLHEWILFVRMRAMPFKYGRNYQQKLVDRTFSDIELRLFEEMKVNSGRIADQYLKDFN TQLRGAIFAYDEGFATDDGTLATAVWRNLFGGRKNIDMVHLESVVRYIYSQLYVLSRLSD REFATGKFKFVPPGVKVEKLTPKQEEELKAKTIAKYEALDKDPKTLPSERSRLSYTN
Uniprot No.

Target Background

Function
A chaperone protein essential for the assembly of the ubiquinol-cytochrome c reductase complex within the mitochondrial respiratory chain.
Gene References Into Functions
  1. Cbp3-Cbp6 also coordinates cytochrome b synthesis with bc1 complex assembly. PMID: 23007649
Database Links

KEGG: sce:YPL215W

STRING: 4932.YPL215W

Protein Families
CBP3 family
Subcellular Location
Mitochondrion membrane.

Q&A

What is the primary function of CBP3 in Saccharomyces cerevisiae?

CBP3 in S. cerevisiae functions as an enzyme-specific chaperone essential for the assembly of ubiquinol-cytochrome c reductase (the bc1 complex) in the mitochondrial respiratory chain. It performs two distinct but interconnected roles: First, as part of the CBP3-CBP6 complex, it interacts with mitochondrial ribosomes to enable efficient translation of mRNAs containing the 5′ untranslated region (UTR) of the COB mRNA, which encodes cytochrome b. Second, the same complex participates as a component of a non-ribosome-bound assembly intermediate of the bc1 complex that contains newly synthesized cytochrome b and the assembly factor Cbp4 . This dual functionality allows for the coupled synthesis and assembly of cytochrome b, facilitating the biogenesis of this central subunit of the bc1 complex .

How does CBP3 interact with the mitochondrial ribosome?

CBP3 binds to mitochondrial ribosomes in proximity to the polypeptide tunnel exit, specifically interacting with Mrpl4, a homologue of the conserved tunnel exit protein L29. This positioning has been confirmed through chemical cross-linking experiments using m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), which revealed a 74-kD cross-linking product between CBP3 and Mrpl4 . The interaction was further validated through Western blotting and by observing CBP3's co-sedimentation with ribosomes in a salt-sensitive manner during centrifugation through high-density sucrose cushions . Quantitative analysis suggests that the levels of CBP3 are sufficient to allow each ribosome to bind one CBP3 protein . Importantly, this interaction requires the formation of a complex between CBP3 and CBP6, as neither protein can bind to the ribosome independently .

What happens to cytochrome b synthesis and stability in the absence of CBP3?

In the absence of CBP3, cells exhibit significantly reduced efficiency in cytochrome b synthesis and complete degradation of newly synthesized cytochrome b within 30 minutes. This has been demonstrated using pulse-chase experiments with [35S]methionine in strains carrying intronless mitochondrial genomes to avoid interference from splicing processes . While CBP3 deletion strains can still synthesize all mitochondrial translation products, cytochrome b is much less efficiently labeled during the pulse phase . This suggests that CBP3 plays a crucial role in both the efficient translation of the COB mRNA and the stabilization of the newly synthesized cytochrome b protein. Interestingly, CBP3 deletion also affects other mitochondrially encoded proteins like Atp6 and Cox1, though this does not impair the accumulation of ATPase and cytochrome c oxidase complexes .

What are the key structural domains of CBP3 and their functions?

CBP3 contains three critical regions that have been identified through mutational analysis:

  • Region 1 (Cys124 through Ala140): This region is essential for CBP3 function. Mutation of Glu134 specifically impairs the ability of the Rieske FeS protein to assemble with the enzyme complex . This suggests that this domain is involved in facilitating specific protein-protein interactions during bc1 complex assembly.

  • Region 2 (Leu167 through Pro175): This region overlaps with the single hydrophobic domain of CBP3 and is necessary for protein stability. Mutations within this area alter the association of CBP3 with the mitochondrial membrane, resulting in enhanced protein turnover . This hydrophobic domain likely facilitates CBP3's membrane association, which is critical for its function in respiratory chain assembly.

  • Region 3 (Gly223 through Asp229): This region is required for CBP3 function, with mutations primarily affecting the assembly of the 14 kDa subunit and cytochrome c1. Gly223 is particularly sensitive to mutation, with the introduction of charged residues at this site compromising CBP3 functional activity .

Additionally, deletion analysis has shown that N-terminal residues 12-96 are not essential for CBP3 function, stability, or mitochondrial import, as strains with these deletions remain respiratory competent . Similarly, the final 44 C-terminal residues are not necessary for function, though alterations in the secondary structure of the extreme C-terminal 17 residues can affect assembly protein activity .

How does the CBP3-CBP6 complex form and what is its significance?

The CBP3-CBP6 complex formation has been demonstrated through multiple experimental approaches. Native purification using His7-tagged variants showed that CBP3 efficiently copurifies with CBP6His7, and conversely, CBP6 copurifies with CBP3His7 . Cross-linking experiments further confirmed this interaction, with a 52-kD band identified as a cross-linking product of CBP6 and CBP3His7 .

The significance of this complex lies in its dual function:

  • Ribosome binding: The complex binds to mitochondrial ribosomes in a manner that requires both proteins. Neither CBP3 nor CBP6 can interact with ribosomes independently, as demonstrated by co-migration experiments with mitochondrial lysates from deletion strains . This binding is critical for efficient translation of COB mRNA.

  • Assembly intermediate formation: The complex acts as part of a non-ribosome-bound assembly intermediate of the bc1 complex, containing newly synthesized cytochrome b and the assembly factor Cbp4 . This function is essential for the proper assembly of cytochrome b into the bc1 complex.

The formation of this complex appears to be a prerequisite for both functions, allowing for the coordinated synthesis and assembly of cytochrome b in mitochondria .

What distinguishes CBP3's role in mRNA stability versus translation?

CBP3's role in cytochrome b synthesis is distinct from mRNA stabilization. While CBP1 is known to be required for stabilization of the COB transcript (as evidenced by the failure of COB mRNA to accumulate in the absence of CBP1), CBP3 does not affect COB mRNA stability . In cells lacking CBP3 or CBP6, the COB mRNA remains stable, indicating that the defect in cytochrome b synthesis in these strains is not caused by lower amounts of the mRNA but rather by impaired translation efficiency .

This functional distinction has been demonstrated by comparing CBP1, CBP3, and CBP6 deletion strains with intron-containing mitochondrial genomes. While CBP1 deletion leads to loss of both COB mRNA and mature COX1 mRNA (which requires an intron of the COB mRNA precursor for maturation), deletion of CBP3 or CBP6 does not affect mRNA levels . This clarifies that CBP3 and CBP6 function primarily in translation and assembly rather than in mRNA processing or stability.

What are effective approaches for studying CBP3-ribosome interactions?

Several complementary approaches have proven effective for studying CBP3-ribosome interactions:

  • Chemical Cross-linking: Using reagents like m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS) with isolated mitochondria carrying His7-tagged versions of ribosomal proteins. This approach has successfully identified cross-linking products between CBP3 and Mrpl4 . The resulting cross-linked products can be purified by metal affinity chromatography and analyzed by either mass spectrometry or Western blotting with specific antibodies.

  • Ribosome Co-sedimentation: This involves lysing mitochondria with detergents like Triton X-100 and fractionating the lysates by centrifugation through a high-density sucrose cushion to separate ribosome-containing pellets from soluble proteins . The salt sensitivity of the interaction can be tested by including different salt concentrations in the lysis and centrifugation buffers. This method demonstrates whether CBP3 physically associates with ribosomes under various conditions.

  • Relative Abundance Analysis: Comparing the amounts of His7-tagged CBP3 and ribosomal proteins (like Mrpl4His7) using Western blotting provides quantitative insights into the stoichiometry of their interaction . This approach helped establish that CBP3 levels are sufficient for each ribosome to bind one CBP3 molecule.

  • Genetic Approaches: Using deletion strains (ΔCBP3, ΔCBP6) to test whether CBP3 and CBP6 can interact independently with mitochondrial ribosomes . These experiments revealed that both proteins are required for ribosome interaction.

When designing such experiments, researchers should consider controls to distinguish specific from nonspecific interactions, such as using unrelated proteins like aconitase as negative controls for ribosome co-sedimentation .

How can researchers analyze the dual functions of the CBP3-CBP6 complex?

To effectively differentiate and analyze the dual functions of the CBP3-CBP6 complex (ribosome binding for translation vs. assembly intermediate formation), researchers can employ the following methodological approaches:

By systematically applying these approaches, researchers can dissect the contributions of the CBP3-CBP6 complex to both translation and assembly processes in mitochondrial biogenesis.

What is the mechanism by which CBP3 recognizes newly synthesized cytochrome b?

The positioning of CBP3 at the mitochondrial ribosomal tunnel exit, specifically its interaction with Mrpl4 (a homologue of the conserved tunnel exit protein L29), supports an early interaction with newly synthesized cytochrome b as it emerges from the ribosome . This strategic location enables CBP3, as part of the CBP3-CBP6 complex, to function as a specialized chaperone that can immediately engage with nascent cytochrome b polypeptides.

The mechanism likely involves:

  • Spatial Proximity: By binding to the ribosomal tunnel exit, CBP3 is positioned to be among the first proteins to contact the emerging cytochrome b polypeptide . This allows for co-translational interaction, which may be critical for preventing misfolding of this hydrophobic membrane protein.

  • Recognition Domains: The functional regions identified in CBP3, particularly Region 1 (Cys124 through Ala140) and Region 3 (Gly223 through Asp229), likely play roles in recognizing specific sequences or structural elements of cytochrome b . The fact that mutations in these regions affect different aspects of bc1 complex assembly suggests they may interact with different domains of cytochrome b or other assembly partners.

  • Cooperative Recognition: The requirement for both CBP3 and CBP6 to form a functional complex suggests that recognition of cytochrome b may involve multiple contact points or a composite binding surface formed by both proteins . This could enhance specificity and efficiency of the recognition process.

  • Sequential Handoff: After initial recognition and binding to newly synthesized cytochrome b, the CBP3-CBP6 complex appears to form part of a non-ribosome-bound assembly intermediate that also contains the assembly factor Cbp4 . This suggests a sequential handoff mechanism where the initial co-translational interaction evolves into a more stable assembly intermediate.

Further structural studies of the CBP3-CBP6 complex in association with ribosome-nascent chain complexes would be valuable for elucidating the precise molecular details of this recognition mechanism.

How do mutations in different regions of CBP3 differentially affect bc1 complex assembly?

Mutations in different regions of CBP3 have been shown to affect bc1 complex assembly in distinct ways, suggesting region-specific roles in the coordination of different assembly steps:

  • Region 1 (Cys124 through Ala140): Mutation of Glu134 in this region specifically impairs the ability of the Rieske FeS protein to assemble with the enzyme complex . This suggests that this domain plays a crucial role in facilitating the incorporation of the Rieske protein during later stages of bc1 complex assembly. The Rieske protein contains an iron-sulfur cluster and is one of the catalytic subunits essential for electron transfer within the complex.

  • Region 2 (Leu167 through Pro175): This region overlaps with CBP3's single hydrophobic domain and appears to be critical for protein stability rather than specific assembly interactions . Mutations in this area alter CBP3's association with the mitochondrial membrane, resulting in enhanced protein turnover . This suggests that proper membrane association of CBP3 is a prerequisite for its function in assembly, possibly by facilitating interactions with membrane-embedded components or assembly intermediates.

  • Region 3 (Gly223 through Asp229): Mutations in this region primarily affect the assembly of the 14 kDa subunit and cytochrome c1 . Gly223 is particularly sensitive to mutation, with the introduction of charged residues at this site severely compromising CBP3 functional activity . This indicates that Region 3 may specifically interact with or facilitate the incorporation of these particular subunits during bc1 complex assembly.

The differential effects of mutations in these regions reveal that CBP3 likely interacts with multiple components of the bc1 complex during its assembly, with different domains specialized for different interactions. This multi-functional capability enables CBP3 to coordinate the complex assembly process from initial cytochrome b synthesis to the incorporation of peripheral subunits like the Rieske protein.

What is the significance of CBP3's positioning at the ribosomal tunnel exit for mitochondrial quality control?

The strategic positioning of CBP3 at the mitochondrial ribosomal tunnel exit represents a crucial quality control checkpoint for several reasons:

  • Co-translational Engagement: By interacting with newly synthesized cytochrome b as it emerges from the ribosome, CBP3 can immediately prevent misfolding or aggregation of this highly hydrophobic protein . This is particularly important in the crowded mitochondrial environment where improper folding could lead to deleterious protein aggregates.

  • Translation-Assembly Coupling: The dual function of the CBP3-CBP6 complex in both translation and assembly creates a direct link between these processes . This coupling ensures that cytochrome b is only synthesized when the machinery for its proper assembly is present and ready, preventing the accumulation of unassembled, potentially toxic intermediates.

  • Rapid Degradation of Unassembled Proteins: In the absence of CBP3, newly synthesized cytochrome b is rapidly degraded (within 30 minutes) . This suggests that CBP3 shields cytochrome b from quality control proteases, and only properly engaged cytochrome b escapes degradation. This represents an efficient mechanism to eliminate potentially harmful unassembled proteins.

  • Regulatory Feedback: The position of CBP3 at the ribosomal exit tunnel potentially allows for regulatory feedback between assembly status and translation rate. If downstream assembly steps are impaired, the CBP3-CBP6 complex might modulate translation efficiency to prevent excessive production of unassembled components.

  • Specialized Chaperone Function: Unlike general chaperones that interact with many different proteins, CBP3 appears to be specialized for cytochrome b . This specialization likely allows for more efficient and accurate folding and assembly specifically tailored to the unique requirements of this protein.

This positioning of CBP3 exemplifies how mitochondria have evolved sophisticated quality control mechanisms that integrate translation with assembly to maintain respiratory chain integrity and prevent the accumulation of potentially toxic assembly intermediates.

What controls should be included when analyzing CBP3's role in cytochrome b synthesis?

When designing experiments to analyze CBP3's role in cytochrome b synthesis, several critical controls should be included to ensure valid and interpretable results:

  • mRNA Stability Controls: Include strains lacking CBP1 (known to affect COB mRNA stability) alongside CBP3 deletion strains to differentiate between translation defects and mRNA stability issues . Quantify COB mRNA levels in all strains to ensure that observed translation defects are not secondary to reduced mRNA availability.

  • Intron Status Controls: Use strains with intronless mitochondrial genomes when focusing specifically on translation, as this eliminates the confounding variable of splicing efficiency . For comprehensive studies, parallel experiments with intron-containing strains may provide insights into any potential role in splicing processes.

  • Protein Stability Controls: Include chase periods of varying lengths after pulse labeling to distinguish between synthesis defects and rapid degradation of newly synthesized proteins . Monitor other mitochondrially encoded proteins as internal controls for general mitochondrial translation capacity.

  • Complex Formation Controls: When analyzing CBP3-CBP6 complex formation, include single deletion strains (ΔCBP3 and ΔCBP6) to assess whether observed phenotypes require both proteins or can be attributed to just one component . Also include experiments assessing interaction with other reported complex components like Cbp4.

  • Ribosome Association Controls: When studying CBP3's association with ribosomes, include treatments with varying salt concentrations to distinguish specific from nonspecific interactions . Use unrelated mitochondrial proteins (like aconitase) as negative controls for ribosome co-sedimentation experiments.

  • Functional Complementation Controls: Include rescue experiments with wild-type CBP3 to confirm that observed defects in deletion strains are specifically due to the absence of CBP3 rather than secondary effects . Consider complementation with mutant versions affecting different functional regions to dissect domain-specific functions.

  • Respiratory Growth Controls: Analyze respiratory capacity (growth on non-fermentable carbon sources) alongside molecular assays to connect molecular defects with physiological outcomes . This provides context for the biological significance of observed molecular changes.

Incorporating these controls will help distinguish direct effects of CBP3 on cytochrome b synthesis from indirect effects on other aspects of mitochondrial function, providing a more complete and accurate understanding of CBP3's role.

How can researchers differentiate between direct and indirect effects of CBP3 mutations?

Differentiating between direct and indirect effects of CBP3 mutations requires a multi-faceted experimental approach:

  • Domain-Specific Mutations: Generate a panel of mutants targeting specific functional regions of CBP3 (Regions 1, 2, and 3) rather than complete deletion strains . This allows for the identification of domain-specific effects and separates functions that may be independent of each other.

  • Temporal Analysis: Conduct time-course experiments to establish the sequence of events following expression of mutant CBP3 proteins. Early effects are more likely to be direct consequences of the mutation, while later effects may represent secondary adaptations or indirect consequences.

  • Interaction Analysis: Perform co-immunoprecipitation or cross-linking experiments with mutant CBP3 proteins to determine which protein-protein interactions are disrupted . This helps identify the primary molecular defect caused by each mutation.

  • Substrate Accumulation Studies: Monitor the accumulation of potential CBP3 substrates (particularly cytochrome b) and assembly intermediates in different mutant backgrounds . Direct effects of CBP3 mutations should lead to specific patterns of substrate accumulation corresponding to the blocked step.

  • Suppressor Screening: Identify genetic suppressors that can rescue the phenotypes of specific CBP3 mutations. Suppressors often highlight functional pathways directly connected to the mutated protein and can distinguish primary from secondary effects.

  • In vitro Reconstitution: Develop in vitro assays using purified components to test specific functions of CBP3, such as binding to ribosomes or interaction with cytochrome b . This removes the complexity of the cellular environment and allows for direct assessment of molecular functions.

  • Quantitative Proteomics: Compare the mitochondrial proteome of wild-type cells with that of cells expressing different CBP3 mutants to identify specific vs. global changes in protein composition. Direct effects should show specific patterns of alteration rather than broad mitochondrial dysfunction.

By systematically applying these approaches, researchers can build a comprehensive understanding of which phenotypes are directly caused by specific CBP3 mutations and which represent downstream or indirect consequences, thereby elucidating the primary functions of different CBP3 domains.

What structural studies would advance our understanding of CBP3 function?

Determining the three-dimensional structure of CBP3, both alone and in complex with its interaction partners, would significantly advance our understanding of its function. High-resolution structural studies using X-ray crystallography or cryo-electron microscopy could reveal the molecular basis for CBP3's interactions with the ribosome, CBP6, and cytochrome b . Of particular interest would be structures of the CBP3-CBP6 complex bound to the mitochondrial ribosomal tunnel exit, which could illuminate how these proteins recognize newly synthesized cytochrome b and facilitate its proper folding and assembly .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.