Recombinant Saccharomyces cerevisiae Protein COS1 (COS1)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant COS1 is produced in E. coli using an in vitro expression system. Key production parameters include:

ParameterDetail
SourceSaccharomyces cerevisiae (strain S288c)
Expression HostE. coli
TagN-terminal 10xHis
Purity>90% (SDS-PAGE verified)
Storage-20°C (short-term); -80°C (long-term); avoid freeze-thaw cycles

Functional Insights

While the specific biological role of COS1 in S. cerevisiae remains uncharacterized, genomic and proteomic data provide clues:

Genetic Interactions

COS1 participates in a network of 84 protein-protein interactions, including physical and genetic associations with:

  • YPT32: A Rab GTPase involved in secretory pathways .

  • SBH1: A subunit of the Sec61 ER translocation complex .

  • HSP42: A heat shock protein linked to stress response .

Conserved Domains

The protein contains transmembrane helices predicted by structural algorithms, suggesting a role in membrane-associated processes. Homologs in other fungi, such as Candida albicans COS1 (a histidine kinase involved in hyphal morphogenesis) , imply potential regulatory functions, though direct evidence in S. cerevisiae is lacking.

Applications in Research

Recombinant COS1 is primarily used for:

  • Antibody Production: As an immunogen for raising antibodies.

  • Structural Studies: Investigating membrane protein topology.

  • Interaction Mapping: Identifying binding partners via pull-down assays.

Future Directions

  • Functional Knockout Studies: To define COS1’s role in yeast physiology.

  • Comparative Analysis: Leveraging homology with C. albicans COS1 to explore conserved pathways .

  • High-Throughput Screens: Integrating CRISPR or proteomics to map its involvement in secretory pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
COS1; YNL336W; N0275; Protein COS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
COS1
Target Protein Sequence
MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLS VWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKRSLSKQLIQFCKEVTENTPSSDPH DWEVVAANLNSYLYENKAWNTKYFFFNAMVCQEAFRTTLLEPFSLKKDEAAKVKSFKDSV PYIEEALGVYFREVEKQWKLFNSEKSWSPVGLEDAKLPKEAYRFKLTWFLKRISNIFMLI PFLNFLCCIYVSRGMCLLLRTFYLGWILFMLVQGFQNMRMIVLSVKMEHKMQFLSTIINE QESGANGWDEIAKKMNRYLFEKKVWKNEEFFFDGIDCEWFFSHFFYRVLSAKKSMRALSL NVELWPYIKEAQLSCSEESLA
Uniprot No.

Target Background

Database Links

KEGG: sce:YNL336W

STRING: 4932.YNL336W

Protein Families
DUP/COS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of COS1 protein in Saccharomyces cerevisiae?

COS1 is a protein encoded by the S. cerevisiae genome with the UniProt accession number P53 . It belongs to a family of proteins involved in membrane trafficking and cell wall biogenesis. The protein participates in crucial cellular processes including protein sorting and transport through the secretory pathway. Researchers investigating COS1 should note its relationships with other membrane-associated proteins and consider its potential role in maintaining cell wall integrity during stress conditions.

What are the structural characteristics of recombinant COS1 protein?

The COS1 protein features domains characteristic of membrane-associated proteins in yeast. While specific structural information for COS1 is limited in the provided research context, experimental approaches can leverage standard techniques for membrane protein characterization. Researchers should consider both native and recombinant forms when designing structural studies, as expression systems may introduce modifications that affect tertiary structure.

Which expression vectors are most suitable for recombinant COS1 production in S. cerevisiae?

Several expression vector systems have demonstrated efficiency for recombinant protein production in S. cerevisiae. Based on experimental evidence, researchers should consider:

  • POT1-based expression systems (POTud and CPOTud), which provide high plasmid stability even when strains are cultivated in rich medium, generating higher cell numbers and higher protein production .

  • Vectors containing strong constitutive promoters such as TEF1 or TPI1, which can drive high gene expression under various glucose conditions .

  • Plasmids with appropriate selection markers. For example, the POT1 gene from Schizosaccharomyces pombe can be used as a marker in combination with deletion of the corresponding S. cerevisiae gene in the genome, allowing selection and maintenance of plasmid-bearing cells .

The following table summarizes key expression vector characteristics:

Expression SystemPromoterMarkerAdvantagesApplications
POTudTEF1POT1High stability, glucose toleranceGeneral recombinant protein expression
CPOTudTPI1POT1Strong expression, high copy numberHigh-yield protein production
Traditional auxotrophy (e.g., p426GPD)GPDURA3Well-characterizedStandard laboratory applications

How do different promoters affect COS1 expression levels?

The choice of promoter significantly impacts recombinant protein expression levels in S. cerevisiae. For COS1 production, several promoters warrant consideration:

  • The TEF1 promoter can drive high gene expression in both high glucose conditions and glucose-limited conditions, making it versatile for various cultivation strategies .

  • The TPI1 promoter, derived from the strongly expressed glycolytic gene TPI1 (coding for triose phosphate isomerase), is frequently used for recombinant protein production and can yield high expression levels .

  • Bidirectional promoters, such as TEF1-PGK1, offer the advantage of expressing multiple genes simultaneously, which can be beneficial when co-expressing chaperones or other factors that enhance COS1 folding and processing .

Researchers should select promoters based on their specific experimental requirements, considering factors such as constitutive versus inducible expression and the desired expression level.

Which leader sequences optimize secretion of recombinant COS1?

Leader sequences play a critical role in directing recombinant proteins through the secretory pathway. For efficient COS1 secretion, consider these research-validated options:

  • The α-factor leader sequence from S. cerevisiae has been extensively used to facilitate secretion of heterologous proteins. This leader directs the protein through translocation into the endoplasmic reticulum (ER) and subsequent trafficking through the secretory pathway .

  • Synthetic leaders such as YAP3-TA57 have been designed to increase both protein solubility and trafficking efficiency through inter-organelle transport .

  • Leaders can be modified to reduce hyperglycosylation and increase processing efficiency. For example, mutations in the α-factor leader can reduce unprocessed and hyperglycosylated proteins, enhancing secretion efficiency .

Experimental data shows that the choice between α-factor leader and synthetic leaders like YAP3-TA57 can significantly affect secretion efficiency depending on the specific protein characteristics .

How does the secretory pathway process COS1 during expression?

The pre-pro leader sequences facilitate secretion through multiple mechanisms. The pre-leader directs the peptide through translocation into the ER, while the pro-leader increases both protein solubility and trafficking efficiency . Processing occurs as follows:

  • The Kex2 protease cleaves the pro-leader at specific recognition sites.

  • Spacer sequences between the leader and protein coding sequence can increase cleavage efficiency of pro-leaders in the late secretory pathway .

  • For optimal processing, the KOZAK sequence (aacaaa) can be inserted before the secretion leader to increase translation efficiency .

Researchers should design constructs with appropriate Kex2 sites (aaaaga) and spacers (gaagaaggtgaaccaaaa) to optimize processing and secretion of the mature COS1 protein .

How can strain engineering improve recombinant COS1 yield and quality?

Advanced strain engineering approaches can significantly enhance COS1 production:

  • Deletion of the native genomic tpi gene, complemented with a functional copy of the heterologous TPI (such as the POT gene from S. pombe), can increase plasmid copy number to sustain rapid growth on glucose, thereby enhancing protein production .

  • Engineering strains with altered glycosylation pathways can reduce hyperglycosylation, which is often a challenge when expressing recombinant proteins in S. cerevisiae .

  • CRISPR/Cas9-based genome editing allows precise modifications to optimize the cellular environment for COS1 production, including deletion of proteases that might degrade the recombinant protein or modification of chaperone expression levels .

What post-translational modifications should be considered when working with recombinant COS1?

Researchers working with COS1 should consider several potential post-translational modifications:

  • Glycosylation: S. cerevisiae often introduces hyperglycosylation, which may affect protein function. The extent of glycosylation depends on the presence of N-glycosylation sites (Asn-X-Ser/Thr) in the protein sequence .

  • GPI anchoring: Some yeast proteins contain glycosylphosphatidylinositol (GPI) anchor signal sequences at their C-terminus. If COS1 contains such motifs, it could potentially become GPI-anchored, affecting its localization and purification strategies .

  • Phosphorylation and other modifications: Various kinases and other modifying enzymes in yeast may introduce additional modifications that could affect protein activity or stability.

Experimental approaches should include verification of the correct processing and modification status of the recombinant COS1 protein.

What media and growth conditions optimize COS1 expression?

Media composition and cultivation conditions significantly impact recombinant protein production. For optimal COS1 expression:

  • Rich media such as YPD (containing 20 g/L D-glucose, 10 g/L yeast extract, 20 g/L peptone, and 1 g/L BSA) supports high cell density and protein production .

  • The addition of bovine serum albumin (BSA) to the medium can stabilize secreted proteins and reduce their degradation by proteases .

  • Temperature, pH, and aeration rates should be optimized, as they affect both cell growth and protein folding. Typical cultivation conditions include 30°C for growth, although lower temperatures (20-25°C) might improve proper folding of complex proteins.

  • For inducible expression systems, the timing and concentration of inducer addition should be carefully optimized through systematic experimental design.

How should researchers troubleshoot low COS1 expression or secretion?

When facing challenges with COS1 expression or secretion, researchers should systematically investigate:

  • Vector construction: Verify the presence of all essential elements (KOZAK sequence, leader sequence, Kex2 site, spacer) and their correct arrangement in the expression construct .

  • Strain selection: Different S. cerevisiae strains may perform differently for recombinant protein expression. Consider testing multiple host strains, such as derivatives of CEN.PK or other laboratory strains .

  • Protein toxicity: If COS1 overexpression is toxic to the host, consider using inducible promoters or secretion strategies to reduce intracellular accumulation.

  • Protein folding and ER stress: Co-expression of chaperones or reduction of expression temperature may alleviate ER stress caused by protein misfolding.

  • Proteolytic degradation: Addition of protease inhibitors to the medium or use of protease-deficient strains can reduce degradation of secreted proteins.

What are the optimal strategies for purifying recombinant COS1?

Purification of recombinant COS1 requires consideration of its biochemical properties and expression strategy:

  • For secreted COS1 (using α-factor or synthetic leaders), initial purification can focus on the culture supernatant, potentially using ammonium sulfate precipitation followed by chromatographic methods .

  • If COS1 contains a fusion tag (such as His-tag or GST), affinity chromatography can be employed for selective purification.

  • Size exclusion chromatography is valuable for removing aggregates and obtaining homogeneous protein preparations.

  • For membrane-associated forms of COS1, detergent extraction followed by specialized chromatography methods may be necessary.

Researchers should optimize purification protocols based on yield, purity, and maintenance of protein activity.

What analytical methods are recommended for verifying COS1 identity and quality?

Comprehensive analysis of purified COS1 should include:

  • SDS-PAGE and Western blotting to confirm protein size and identity.

  • Mass spectrometry for accurate molecular weight determination and identification of post-translational modifications.

  • Circular dichroism spectroscopy to assess secondary structure content and proper folding.

  • Size exclusion chromatography or analytical ultracentrifugation to evaluate oligomeric state and homogeneity.

  • Functional assays specific to COS1's biological activity to confirm that the recombinant protein retains its native function.

What are the recommended storage conditions for maintaining COS1 stability?

Based on general protein stability principles and specific guidance for recombinant proteins:

  • Short-term storage: Store at -20°C in appropriate buffer conditions with stabilizing agents such as glycerol .

  • Long-term storage: For extended periods, store at -80°C in small aliquots to avoid repeated freeze-thaw cycles that can lead to protein degradation .

  • Consider the addition of stabilizing agents such as glycerol (10-20%), reducing agents if the protein contains cysteine residues, and protease inhibitors to prevent degradation.

  • Lyophilization may be an option for very long-term storage, though optimization of the lyophilization buffer is crucial to maintain protein activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.